Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3184.t1
Gene name
Locationscaffold_04:914844..916306
Strand+
Gene length (bp)1462
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.8E-24 74 406

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 97 119 22
3 132 151 19
4 161 183 22
5 188 210 22
6 220 237 17
7 262 284 22
8 299 318 19
9 325 347 22
10 357 379 22
11 391 413 22
12 423 445 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.35 8.73 27.96
5d_25C Five days - 25 degrees Celsius 16.78 7.94 25.62
7d_25C Seven days - 25 degrees Celsius 16.13 7.10 25.17
10d_25C Ten days - 25 degrees Celsius 7.05 2.23 11.87
7d_15C Seven days - 15 degrees Celsius 17.26 7.21 27.30
7d_30C Seven days - 30 degrees Celsius 19.04 9.09 28.99

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.833486 no
3d_25C 7d_25C 0.745789 no
3d_25C 7d_15C 0.896675 no
3d_25C 7d_30C 0.935143 no
3d_25C 10d_25C 0.006000 yes
5d_25C 7d_25C 0.933801 no
5d_25C 7d_15C 0.957304 no
5d_25C 7d_30C 0.750109 no
5d_25C 10d_25C 0.013513 yes
7d_25C 7d_15C 0.887863 no
7d_25C 7d_30C 0.666920 no
7d_25C 10d_25C 0.019090 yes
7d_15C 7d_30C 0.823568 no
7d_15C 10d_25C 0.012303 yes
7d_30C 10d_25C 0.003197 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3184.t1
MGQRNIPQSSAAGICSTTAGSSYTTSATTYNEESPIFVQQDPRQQDEYRKAENNEIPNGGLVAWTQVLTGHLVVF
NVWGYITSYGFFQEYYVKTLDVSPANASWIGAVQMFLVHFLATFSGRAMDAGYLRQCITLGCFFQVAGALATSFG
TRLWHFWLAQGVVSGIGHGLVFSPMISLYATYFNSKRVMAVSLASCGAATGGMVFPVVAYKCLNNIGFAWTVRIM
AAIILFNSIIIIKFTRARIIPRSPPPWVDFSAFRERPYLLFSIGSFLIFEGIYFAYIYLRQYAQAHTGFTASDSL
LLLILMNGVGVASRIASAFVADRWLGAVRTCIAVSIPCGIAILGWIGVHTRVGMFIWATVYGLLVNCAQSQLPAA
NAYFGSKDPEKSGTRVGMITTINSIPLLTGPYIAGQLIALRGGDYLYAQLFGGICILTGALFVVGSHLSGA*
Coding >Pro_DTO377G3_2|g3184.t1
ATGGGCCAGCGAAACATACCACAGAGCAGTGCGGCCGGAATATGCTCGACGACCGCTGGTTCGTCCTACACAACG
TCGGCCACTACCTATAACGAAGAGTCCCCGATATTTGTTCAACAAGATCCTCGCCAACAAGATGAATACCGCAAA
GCTGAGAACAATGAGATCCCCAATGGGGGTCTCGTAGCCTGGACCCAGGTTCTGACTGGACATCTGGTTGTGTTC
AATGTATGGGGCTACATTACATCGTACGGTTTCTTCCAAGAATACTATGTCAAAACTCTCGATGTCAGCCCAGCA
AATGCATCTTGGATCGGAGCGGTGCAGATGTTCTTAGTCCATTTCCTGGCCACTTTCTCAGGCCGAGCGATGGAC
GCAGGCTACCTGAGACAATGCATCACCCTTGGATGTTTCTTCCAGGTTGCCGGGGCATTGGCGACCTCATTCGGC
ACAAGGTTATGGCATTTTTGGTTAGCGCAAGGCGTTGTCAGTGGAATTGGCCACGGACTCGTCTTCAGCCCCATG
ATCTCGCTGTATGCGACATACTTCAACTCCAAGCGAGTGATGGCCGTCTCGCTGGCATCTTGCGGGGCAGCGACT
GGGGGGATGGTTTTCCCAGTGGTCGCGTATAAGTGTCTCAACAATATCGGCTTCGCATGGACTGTCCGGATTATG
GCAGCCATTATCCTATTCAACAGCATTATAATTATCAAGTTTACCAGAGCTCGGATTATACCTCGGAGTCCTCCT
CCCTGGGTTGATTTCAGTGCATTCCGTGAACGCCCTTACCTCCTTTTTTCGATCGGCTCATTCCTGATCTTCGAG
GGTATTTACTTTGCCTACATTTATCTCAGACAATATGCCCAGGCCCATACAGGTTTCACCGCATCTGACTCACTT
CTCCTTTTAATCCTGATGAACGGCGTTGGTGTTGCGTCTCGAATTGCATCCGCATTTGTGGCAGACCGGTGGCTG
GGTGCGGTAAGGACTTGCATTGCAGTCTCCATCCCTTGCGGTATCGCCATTCTAGGGTGGATTGGTGTACACACC
CGCGTTGGCATGTTCATCTGGGCTACAGTCTATGGGTTACTGGTTAATTGTGCGCAGAGTCAATTGCCCGCTGCC
AATGCATACTTTGGATCCAAAGACCCGGAAAAATCAGGCACACGTGTTGGGATGATCACCACGATCAATAGCATT
CCACTACTGACTGGACCGTACATAGCAGGGCAGCTGATCGCGTTACGGGGAGGCGATTACCTGTACGCGCAGTTG
TTCGGCGGTATTTGTATCTTGACTGGAGCGTTGTTTGTAGTCGGTTCTCACCTTTCGGGAGCTTGA
Transcript >Pro_DTO377G3_2|g3184.t1
ATGGGCCAGCGAAACATACCACAGAGCAGTGCGGCCGGAATATGCTCGACGACCGCTGGTTCGTCCTACACAACG
TCGGCCACTACCTATAACGAAGAGTCCCCGATATTTGTTCAACAAGATCCTCGCCAACAAGATGAATACCGCAAA
GCTGAGAACAATGAGATCCCCAATGGGGGTCTCGTAGCCTGGACCCAGGTTCTGACTGGACATCTGGTTGTGTTC
AATGTATGGGGCTACATTACATCGTACGGTTTCTTCCAAGAATACTATGTCAAAACTCTCGATGTCAGCCCAGCA
AATGCATCTTGGATCGGAGCGGTGCAGATGTTCTTAGTCCATTTCCTGGCCACTTTCTCAGGCCGAGCGATGGAC
GCAGGCTACCTGAGACAATGCATCACCCTTGGATGTTTCTTCCAGGTTGCCGGGGCATTGGCGACCTCATTCGGC
ACAAGGTTATGGCATTTTTGGTTAGCGCAAGGCGTTGTCAGTGGAATTGGCCACGGACTCGTCTTCAGCCCCATG
ATCTCGCTGTATGCGACATACTTCAACTCCAAGCGAGTGATGGCCGTCTCGCTGGCATCTTGCGGGGCAGCGACT
GGGGGGATGGTTTTCCCAGTGGTCGCGTATAAGTGTCTCAACAATATCGGCTTCGCATGGACTGTCCGGATTATG
GCAGCCATTATCCTATTCAACAGCATTATAATTATCAAGTTTACCAGAGCTCGGATTATACCTCGGAGTCCTCCT
CCCTGGGTTGATTTCAGTGCATTCCGTGAACGCCCTTACCTCCTTTTTTCGATCGGCTCATTCCTGATCTTCGAG
GGTATTTACTTTGCCTACATTTATCTCAGACAATATGCCCAGGCCCATACAGGTTTCACCGCATCTGACTCACTT
CTCCTTTTAATCCTGATGAACGGCGTTGGTGTTGCGTCTCGAATTGCATCCGCATTTGTGGCAGACCGGTGGCTG
GGTGCGGTAAGGACTTGCATTGCAGTCTCCATCCCTTGCGGTATCGCCATTCTAGGGTGGATTGGTGTACACACC
CGCGTTGGCATGTTCATCTGGGCTACAGTCTATGGGTTACTGGTTAATTGTGCGCAGAGTCAATTGCCCGCTGCC
AATGCATACTTTGGATCCAAAGACCCGGAAAAATCAGGCACACGTGTTGGGATGATCACCACGATCAATAGCATT
CCACTACTGACTGGACCGTACATAGCAGGGCAGCTGATCGCGTTACGGGGAGGCGATTACCTGTACGCGCAGTTG
TTCGGCGGTATTTGTATCTTGACTGGAGCGTTGTTTGTAGTCGGTTCTCACCTTTCGGGAGCTTGA
Gene >Pro_DTO377G3_2|g3184.t1
ATGGGCCAGCGAAACATACCACAGAGCAGTGCGGCCGGAATATGCTCGACGACCGCTGGTTCGTCCTACACAACG
TCGGCCACTACCTATAACGAAGAGTCCCCGATATTTGTTCAACAAGATCCTCGCCAACAAGATGAATACCGCAAA
GCTGAGAACAATGAGATCCCCAATGGGGGTCTCGTAGCCTGGACCCAGGTTCTGACTGGACATCTGGTTGTGTTC
AATGTATGGGGCTACATTACATCGTAAGGGAGCCCCGTCACATAAGATATTAATTCAAACCATTGACGCAATCTA
GGTACGGTTTCTTCCAAGAATACTATGTCAAAACTCTCGATGTCAGCCCAGCAAATGCATCTTGGATCGGAGCGG
TGCAGATGTTCTTAGTCCATTTCCTGGCCACTTTCTCAGGCCGAGCGATGGACGCAGGCTACCTGAGACAATGCA
TCACCCTTGGATGTTTCTTCCAGGTTGCCGGGGCATTGGCGACCTCATTCGGCACAAGGTTATGGCATTTTTGGT
TAGCGCAAGGCGTTGTCAGTGGAATTGGCCACGGACTCGTCTTCAGCCCCATGATCTCGCTGTATGCGACATACT
TCAACTCCAAGCGAGTGATGGCCGTCTCGCTGGCATCTTGCGGGGCAGCGACTGGGGGGATGGTTTTCCCAGTGG
TCGCGTATAAGTGTCTCAACAATATCGGCTTCGCATGGACTGTCCGGATTATGGCAGCCATTATCCTATTCAACA
GCATTATAATTATCAAGTTTACCAGAGCTCGGATTATACCTCGGAGTCCTCCTCCCTGGGTTGATTTCAGTGCAT
TCCGTGAACGCCCTTACCTCCTTTTTTCGATCGGCTCATTCCTGATCTTCGAGGGTATTTACTTTGCCTACATTT
ATGTAAGTTCTGTCTTGTTTCTCACATTGGTTGGCGGCATAATAGCTAACATACCTAACAACATCTACAGCTCAG
ACAATATGCCCAGGCCCATACAGGTTTCACCGCATCTGACTCACTTCTCCTTTTAATCCTGATGAACGGCGTTGG
TGTTGCGTCTCGAATTGCATCCGCATTTGTGGCAGACCGGTGGCTGGGTGCGGTAAGGACTTGCATTGCAGTCTC
CATCCCTTGCGGTATCGCCATTCTAGGGTGGATTGGTGTACACACCCGCGTTGGCATGTTCATCTGGGCTACAGT
CTATGGGTTACTGGTTAATTGTGCGCAGAGTCAATTGCCCGCTGCCAATGCATACTTTGGATCCAAAGACCCGGA
AAAATCAGGCACACGTGTTGGGATGATCACCACGATCAATAGCATTCCACTACTGACTGGACCGTACATAGCAGG
GCAGCTGATCGCGTTACGGGGAGGCGATTACCTGTACGCGCAGTTGTTCGGCGGTATTTGTATCTTGACTGGAGC
GTTGTTTGTAGTCGGTTCTCACCTTTCGGGAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail