Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3144.t1
Gene name
Locationscaffold_04:818545..822205
Strand-
Gene length (bp)3660
Transcript length (bp)3393
Coding sequence length (bp)3393
Protein length (aa) 1131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.6E-10 539 656
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.3E-15 938 1086
PF03733 YccF Inner membrane component domain 2.5E-14 267 319

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 274 296 22
2 412 434 22
3 439 458 19
4 504 526 22
5 536 558 22
6 571 593 22
7 603 625 22
8 637 659 22
9 704 726 22
10 939 961 22
11 971 993 22
12 1006 1028 22
13 1043 1065 22
14 1072 1094 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3144.t1
MAGDKGNPGSPESTQPSAMAGMETPTPEAVPPIRSSASARRTYGTLDPSSSEATNPELNDDGQDESLTRAFTTQS
STVPDKPRKPSVSRRMSSKRPIPHRGQGFSTDDDVNEVKQYMTMKQGANPQQSPRIRPLRTQSSTLRRRPSARPR
PLARADSEGYNADETALPEAGLDYEEEFPSLKQTGHTSGGESEDGEEEGGIEDDEDAASDAESFTLKDRQQAINQ
THPFGIRLWKPALYKKSRSVEKTAEGDIHSSPGGYVSPMLFLTNLLWSLFFGWWLALFALLAAVACFFFSYSSSA
VAYGRVFAGLSRYLLYPFGSYVLLETEENYAEEDEGEGRSISEYEQWQNGDLEHGRLFFGPRRDRSLVGRRRNSV
DSAGEQDSLLGRPQRGQREESSQLAQSKRRLFGRGEWTLGRVVFFVFFYFLVGPLMLMVSLVCWLLVFWIPMGRI
TITLVSHLRRHPLALSFHSDSRYARSSTTTSSSSILLCTYRAAGTRYWKYTLDGTNIFLINLLGVVVFVIFDYHV
LGKFLGLQNWLTHPALIFPLALLSIIPLAYFIGQAVASISAQSSMGLGAAINAFFSTIVEVYLYCVALTEGKAQL
VEGSIIGSIFVGILFLPGLSMCFGALKRKTQRFNVKSAGVTSTMLLFAVIAAFGPTLFYQVYGSHELNCHSCVSS
LDPETRDCRRCYFSQTAAVDDQFFQKAVQPYAWIAAVFLFLSYGIGLWFTLRTHAALIWASEMEEKKNSHPHAHA
HATQSAQESFYEPRHMFPNGQPEASGAASGSKDSIRESQLYKRILGQSLKHLGLEDNDSGNWEGAGSEAADLRGN
FPHLVPPNPSGEDGYPVPKFVRNMAQEDNERLVRQFTEVAATAATVAARDTARSRKPNVQHHQASVRQSSRPAPE
RSRNTPGEELEDLGLSVEPTHSSGGHDAPNWSKVKSSVILLGATVLYAVIAEILVNTVDVVLESVDIDEKFLGIT
LFALVPNTTEFLNAISFAMNGNIALSMEIGSAYALQVCLLQIPAVVFFSAFYGRSLDPSELVSHSFNLIFPQWDM
ITVIMCVFLLSHVYGEGKSNYFKGSILVLTYLVVVLGFHMSGYVNMDSMGVDRFDTLAIGSTSSSNKFYTVGRTR
GGVAY*
Coding >Pro_DTO377G3_2|g3144.t1
ATGGCTGGCGATAAAGGAAACCCTGGCTCTCCCGAGTCCACGCAGCCATCTGCGATGGCGGGAATGGAAACACCA
ACTCCTGAAGCTGTGCCTCCAATCAGATCCTCTGCCTCCGCGCGGAGAACATACGGTACACTCGATCCATCCTCC
TCCGAGGCGACCAATCCTGAACTAAATGATGATGGCCAAGACGAGAGTTTGACTCGCGCATTCACGACTCAATCT
TCTACTGTCCCTGATAAGCCCCGAAAGCCCTCGGTATCGCGTCGCATGTCTTCCAAACGTCCAATCCCCCACAGA
GGGCAAGGGTTCTCGACAGATGATGATGTCAATGAGGTCAAGCAATATATGACGATGAAGCAAGGCGCGAACCCG
CAACAATCACCCAGGATTCGCCCACTACGAACGCAAAGCTCGACCTTGAGACGACGTCCCAGTGCTCGTCCCAGA
CCCTTGGCAAGAGCCGATTCGGAGGGTTACAACGCAGACGAAACGGCCTTACCTGAAGCAGGTCTGGATTATGAA
GAAGAGTTTCCTTCGTTGAAACAAACCGGACATACCAGTGGAGGGGAGAGTGAGGACGGTGAGGAGGAGGGTGGA
ATAGAAGACGATGAAGACGCAGCCAGCGATGCTGAGAGCTTCACACTCAAAGACCGTCAACAGGCCATCAACCAA
ACACACCCGTTTGGTATCAGACTCTGGAAGCCTGCGTTGTACAAGAAAAGCCGTTCTGTAGAGAAAACGGCCGAG
GGTGATATCCACTCTTCTCCAGGAGGCTATGTCAGTCCCATGCTTTTTTTGACCAATCTACTATGGTCTTTGTTT
TTTGGATGGTGGCTTGCCCTTTTCGCTCTGTTAGCCGCAGTTGCTTGCTTTTTTTTTTCCTACTCATCCAGTGCT
GTGGCATACGGAAGAGTATTTGCAGGTCTTTCACGATATCTGTTATACCCGTTCGGATCATATGTTCTTCTGGAG
ACCGAGGAGAATTATGCCGAGGAAGATGAAGGCGAGGGACGCAGTATCAGCGAATATGAACAATGGCAGAATGGC
GACCTGGAACATGGCCGTCTTTTCTTCGGCCCTCGCAGAGATCGGTCCCTGGTCGGTAGACGAAGAAACAGCGTC
GATTCAGCCGGTGAACAAGACAGCCTGCTCGGGCGACCCCAGCGTGGACAACGCGAAGAGTCCTCTCAGCTCGCT
CAATCCAAGCGTCGCCTCTTTGGGCGGGGCGAATGGACCTTGGGTCGCGTCGTGTTCTTCGTGTTCTTCTACTTC
CTAGTTGGTCCGCTGATGCTTATGGTATCGCTCGTCTGCTGGCTCTTGGTGTTTTGGATTCCCATGGGTCGTATA
ACGATTACACTCGTGAGCCATTTGCGCAGACATCCGCTAGCACTGTCCTTCCATTCCGATTCCAGATATGCTAGA
TCGAGCACAACCACATCTTCGTCTTCCATACTTCTTTGTACCTACAGAGCTGCTGGAACGAGGTACTGGAAGTAC
ACTCTCGATGGAACGAACATCTTTTTGATCAATCTTCTTGGCGTGGTTGTGTTTGTGATTTTCGACTACCATGTT
TTGGGCAAATTCTTAGGCTTGCAGAATTGGCTCACACATCCGGCCTTGATCTTCCCTCTCGCGTTGCTCTCCATT
ATTCCTCTGGCCTATTTCATTGGACAAGCCGTCGCCTCGATCTCCGCTCAATCTTCTATGGGCTTAGGTGCTGCC
ATCAATGCTTTCTTCTCAACTATCGTAGAAGTATATCTCTACTGTGTCGCTTTGACTGAGGGCAAGGCTCAGCTT
GTCGAGGGAAGTATCATCGGCAGTATCTTTGTCGGCATTTTATTCCTCCCTGGTTTGTCCATGTGCTTTGGTGCA
CTCAAACGCAAGACCCAACGGTTCAATGTGAAATCAGCTGGTGTGACCTCGACGATGTTGTTGTTTGCGGTTATT
GCTGCCTTTGGTCCCACCCTCTTCTATCAGGTTTATGGTAGTCATGAGCTGAACTGCCACTCGTGTGTAAGTTCC
CTCGATCCAGAGACTCGAGATTGCAGGCGCTGCTATTTCTCACAAACAGCGGCTGTCGATGATCAATTCTTTCAA
AAAGCGGTACAGCCATATGCATGGATCGCCGCTGTTTTCTTGTTCCTTTCATACGGCATCGGCCTATGGTTTACT
CTTAGGACCCACGCTGCTCTTATCTGGGCATCAGAGATGGAAGAAAAAAAGAATTCCCATCCCCATGCCCATGCC
CATGCCACCCAATCTGCCCAAGAATCATTCTACGAGCCACGGCACATGTTCCCAAATGGCCAGCCCGAAGCTTCT
GGTGCCGCTTCTGGGTCCAAAGATTCGATCCGTGAATCTCAGCTGTATAAGCGAATCTTAGGCCAGTCATTGAAG
CATCTTGGCTTGGAGGACAATGACTCTGGCAATTGGGAAGGGGCTGGAAGTGAAGCCGCAGACCTCAGGGGCAAT
TTCCCACACTTGGTGCCCCCCAATCCTAGCGGCGAGGACGGTTACCCTGTGCCAAAGTTTGTCCGTAATATGGCC
CAAGAAGACAACGAGCGTCTAGTACGCCAGTTCACCGAAGTAGCAGCAACAGCAGCAACAGTGGCTGCTCGGGAT
ACGGCTCGAAGTCGCAAGCCCAATGTACAACACCATCAAGCCTCTGTTCGTCAATCTAGCCGCCCTGCTCCGGAG
CGATCACGAAATACACCTGGGGAAGAGCTTGAAGATCTCGGGTTGAGTGTGGAGCCCACTCATTCTAGCGGAGGA
CATGATGCACCTAATTGGAGCAAAGTTAAAAGCTCTGTCATTCTTCTTGGGGCAACTGTCCTCTATGCAGTGATT
GCTGAAATTCTTGTCAACACGGTTGATGTTGTGCTAGAGAGCGTGGATATTGATGAGAAATTCCTCGGCATTACT
CTTTTCGCGTTGGTGCCAAATACGACGGAGTTCCTAAACGCCATCTCATTTGCCATGAACGGAAACATTGCATTA
TCTATGGAAATTGGGTCTGCCTATGCACTACAGGTCTGTCTATTGCAGATTCCTGCTGTGGTATTCTTCAGCGCT
TTCTATGGCCGCTCGCTAGACCCATCTGAGCTTGTCAGCCACTCATTCAACCTAATATTCCCGCAGTGGGATATG
ATTACCGTTATTATGTGCGTCTTCCTTCTCTCGCATGTATACGGCGAAGGAAAGAGCAACTACTTTAAGGGATCC
ATCCTTGTACTCACCTACCTCGTCGTTGTGCTTGGCTTCCATATGTCAGGCTATGTGAATATGGACAGTATGGGC
GTGGATCGCTTTGATACCCTAGCCATAGGCAGCACCAGTAGTTCCAACAAGTTCTACACTGTTGGCCGAACAAGA
GGCGGGGTGGCCTACTAG
Transcript >Pro_DTO377G3_2|g3144.t1
ATGGCTGGCGATAAAGGAAACCCTGGCTCTCCCGAGTCCACGCAGCCATCTGCGATGGCGGGAATGGAAACACCA
ACTCCTGAAGCTGTGCCTCCAATCAGATCCTCTGCCTCCGCGCGGAGAACATACGGTACACTCGATCCATCCTCC
TCCGAGGCGACCAATCCTGAACTAAATGATGATGGCCAAGACGAGAGTTTGACTCGCGCATTCACGACTCAATCT
TCTACTGTCCCTGATAAGCCCCGAAAGCCCTCGGTATCGCGTCGCATGTCTTCCAAACGTCCAATCCCCCACAGA
GGGCAAGGGTTCTCGACAGATGATGATGTCAATGAGGTCAAGCAATATATGACGATGAAGCAAGGCGCGAACCCG
CAACAATCACCCAGGATTCGCCCACTACGAACGCAAAGCTCGACCTTGAGACGACGTCCCAGTGCTCGTCCCAGA
CCCTTGGCAAGAGCCGATTCGGAGGGTTACAACGCAGACGAAACGGCCTTACCTGAAGCAGGTCTGGATTATGAA
GAAGAGTTTCCTTCGTTGAAACAAACCGGACATACCAGTGGAGGGGAGAGTGAGGACGGTGAGGAGGAGGGTGGA
ATAGAAGACGATGAAGACGCAGCCAGCGATGCTGAGAGCTTCACACTCAAAGACCGTCAACAGGCCATCAACCAA
ACACACCCGTTTGGTATCAGACTCTGGAAGCCTGCGTTGTACAAGAAAAGCCGTTCTGTAGAGAAAACGGCCGAG
GGTGATATCCACTCTTCTCCAGGAGGCTATGTCAGTCCCATGCTTTTTTTGACCAATCTACTATGGTCTTTGTTT
TTTGGATGGTGGCTTGCCCTTTTCGCTCTGTTAGCCGCAGTTGCTTGCTTTTTTTTTTCCTACTCATCCAGTGCT
GTGGCATACGGAAGAGTATTTGCAGGTCTTTCACGATATCTGTTATACCCGTTCGGATCATATGTTCTTCTGGAG
ACCGAGGAGAATTATGCCGAGGAAGATGAAGGCGAGGGACGCAGTATCAGCGAATATGAACAATGGCAGAATGGC
GACCTGGAACATGGCCGTCTTTTCTTCGGCCCTCGCAGAGATCGGTCCCTGGTCGGTAGACGAAGAAACAGCGTC
GATTCAGCCGGTGAACAAGACAGCCTGCTCGGGCGACCCCAGCGTGGACAACGCGAAGAGTCCTCTCAGCTCGCT
CAATCCAAGCGTCGCCTCTTTGGGCGGGGCGAATGGACCTTGGGTCGCGTCGTGTTCTTCGTGTTCTTCTACTTC
CTAGTTGGTCCGCTGATGCTTATGGTATCGCTCGTCTGCTGGCTCTTGGTGTTTTGGATTCCCATGGGTCGTATA
ACGATTACACTCGTGAGCCATTTGCGCAGACATCCGCTAGCACTGTCCTTCCATTCCGATTCCAGATATGCTAGA
TCGAGCACAACCACATCTTCGTCTTCCATACTTCTTTGTACCTACAGAGCTGCTGGAACGAGGTACTGGAAGTAC
ACTCTCGATGGAACGAACATCTTTTTGATCAATCTTCTTGGCGTGGTTGTGTTTGTGATTTTCGACTACCATGTT
TTGGGCAAATTCTTAGGCTTGCAGAATTGGCTCACACATCCGGCCTTGATCTTCCCTCTCGCGTTGCTCTCCATT
ATTCCTCTGGCCTATTTCATTGGACAAGCCGTCGCCTCGATCTCCGCTCAATCTTCTATGGGCTTAGGTGCTGCC
ATCAATGCTTTCTTCTCAACTATCGTAGAAGTATATCTCTACTGTGTCGCTTTGACTGAGGGCAAGGCTCAGCTT
GTCGAGGGAAGTATCATCGGCAGTATCTTTGTCGGCATTTTATTCCTCCCTGGTTTGTCCATGTGCTTTGGTGCA
CTCAAACGCAAGACCCAACGGTTCAATGTGAAATCAGCTGGTGTGACCTCGACGATGTTGTTGTTTGCGGTTATT
GCTGCCTTTGGTCCCACCCTCTTCTATCAGGTTTATGGTAGTCATGAGCTGAACTGCCACTCGTGTGTAAGTTCC
CTCGATCCAGAGACTCGAGATTGCAGGCGCTGCTATTTCTCACAAACAGCGGCTGTCGATGATCAATTCTTTCAA
AAAGCGGTACAGCCATATGCATGGATCGCCGCTGTTTTCTTGTTCCTTTCATACGGCATCGGCCTATGGTTTACT
CTTAGGACCCACGCTGCTCTTATCTGGGCATCAGAGATGGAAGAAAAAAAGAATTCCCATCCCCATGCCCATGCC
CATGCCACCCAATCTGCCCAAGAATCATTCTACGAGCCACGGCACATGTTCCCAAATGGCCAGCCCGAAGCTTCT
GGTGCCGCTTCTGGGTCCAAAGATTCGATCCGTGAATCTCAGCTGTATAAGCGAATCTTAGGCCAGTCATTGAAG
CATCTTGGCTTGGAGGACAATGACTCTGGCAATTGGGAAGGGGCTGGAAGTGAAGCCGCAGACCTCAGGGGCAAT
TTCCCACACTTGGTGCCCCCCAATCCTAGCGGCGAGGACGGTTACCCTGTGCCAAAGTTTGTCCGTAATATGGCC
CAAGAAGACAACGAGCGTCTAGTACGCCAGTTCACCGAAGTAGCAGCAACAGCAGCAACAGTGGCTGCTCGGGAT
ACGGCTCGAAGTCGCAAGCCCAATGTACAACACCATCAAGCCTCTGTTCGTCAATCTAGCCGCCCTGCTCCGGAG
CGATCACGAAATACACCTGGGGAAGAGCTTGAAGATCTCGGGTTGAGTGTGGAGCCCACTCATTCTAGCGGAGGA
CATGATGCACCTAATTGGAGCAAAGTTAAAAGCTCTGTCATTCTTCTTGGGGCAACTGTCCTCTATGCAGTGATT
GCTGAAATTCTTGTCAACACGGTTGATGTTGTGCTAGAGAGCGTGGATATTGATGAGAAATTCCTCGGCATTACT
CTTTTCGCGTTGGTGCCAAATACGACGGAGTTCCTAAACGCCATCTCATTTGCCATGAACGGAAACATTGCATTA
TCTATGGAAATTGGGTCTGCCTATGCACTACAGGTCTGTCTATTGCAGATTCCTGCTGTGGTATTCTTCAGCGCT
TTCTATGGCCGCTCGCTAGACCCATCTGAGCTTGTCAGCCACTCATTCAACCTAATATTCCCGCAGTGGGATATG
ATTACCGTTATTATGTGCGTCTTCCTTCTCTCGCATGTATACGGCGAAGGAAAGAGCAACTACTTTAAGGGATCC
ATCCTTGTACTCACCTACCTCGTCGTTGTGCTTGGCTTCCATATGTCAGGCTATGTGAATATGGACAGTATGGGC
GTGGATCGCTTTGATACCCTAGCCATAGGCAGCACCAGTAGTTCCAACAAGTTCTACACTGTTGGCCGAACAAGA
GGCGGGGTGGCCTACTAG
Gene >Pro_DTO377G3_2|g3144.t1
ATGGCTGGCGATAAAGGAAACCCTGGCTCTCCCGAGTCCACGCAGCCATCTGCGATGGCGGGAATGGAAACACCA
ACTCCTGAAGCTGTGCCTCCAATCAGATCCTCTGCCTCCGCGCGGAGAACATACGGTAAGCTTGCCTTTGGTGTA
ACCTACAACAATGACGGCTTGGGTTGATCCAAAATTGCAGGTACACTCGATCCATCCTCCTCCGAGGCGACCAAT
CCTGAACTAAATGATGATGGCCAAGACGAGAGTTTGACTCGCGCATTCACGACTCAATCTTCTACTGTCCCTGAT
AAGCCCCGAAAGCCCTCGGTATCGCGTCGCATGTCTTCCAAACGTCCAATCCCCCACAGAGGGCAAGGGTTCTCG
ACAGATGATGATGTCAATGAGGTCAAGCAATATATGACGATGAAGCAAGGCGCGAACCCGCAACAATCACCCAGG
ATTCGCCCACTACGAACGCAAAGCTCGACCTTGAGACGACGTCCCAGTGCTCGTCCCAGACCCTTGGCAAGAGCC
GATTCGGAGGGTTACAACGCAGACGAAACGGCCTTACCTGAAGCAGGTCTGGATTATGAAGAAGAGTTTCCTTCG
TTGAAACAAACCGGACATACCAGTGGAGGGGAGAGTGAGGACGGTGAGGAGGAGGGTGGAATAGAAGACGATGAA
GACGCAGCCAGCGATGCTGAGAGCTTCACACTCAAAGACCGTCAACAGGCCATCAACCAAACACACCCGTTTGGT
ATCAGACTCTGGAAGCCTGCGTTGTACAAGAAAAGCCGTTCTGTAGAGAAAACGGCCGAGGGTGATATCCACTCT
TCTCCAGGAGGCTATGTCAGTCCCATGCTTTTTTTGACCAATCTACTATGGTCTTTGTTTTTTGGATGGTGGCTT
GCCCTTTTCGCTCTGTTAGCCGCAGTTGCTTGCTTTTTTTTTTCCTACTCATCCAGTGCTGTGGCATACGGAAGA
GTATTTGCAGGTCTTTCACGATATCTGTTATACCCGTTCGGATCATATGTTCTTCTGGAGACCGAGGAGAATTAT
GCCGAGGAAGATGAAGGCGAGGGACGCAGTATCAGCGAATATGAACAATGGCAGAATGGCGACCTGGAACATGGC
CGTCTTTTCTTCGGCCCTCGCAGAGATCGGTCCCTGGTCGGTAGACGAAGAAACAGCGTCGATTCAGCCGGTGAA
CAAGACAGCCTGCTCGGGCGACCCCAGCGTGGACAACGCGAAGAGTCCTCTCAGCTCGCTCAATCCAAGCGTCGC
CTCTTTGGGCGGGGCGAATGGACCTTGGGTCGCGTCGTGTTCTTCGTGTTCTTCTACTTCCTAGTTGGTCCGCTG
ATGCTTATGGTATCGCTCGTCTGCTGGCTCTTGGTGTTTTGGATTCCCATGGGTCGTATAACGATTACACTCGTG
AGCCATTTGCGCAGACATCCGCTAGCACTGTCCTTCCATTCCGATTCCAGATATGCTAGATCGAGCACAACCACA
TCTTCGTCTTCCATACTTCTTTGTACCTACAGAGCTGCTGGAACGAGGTACTGGAAGTACACTCTCGATGGAACG
AACATCTTTTTGATCAATCTTCTTGGCGTGGTTGTGTTTGTGATTTTCGACTACCATGTTTTGGGCAAATTCTTA
GGCTTGCAGAATTGGCTCACACATCCGGCCTTGATCTTCCCTCTCGCGTTGCTCTCCATTATTCCTCTGGCCTAT
TTCATTGGACAAGCCGTCGCCTCGATCTCCGCTCAATCTTCTATGGGCTTAGGTGCTGCCATCAATGCTTTCTTC
TCAACTATCGTAGAAGTATATCTCTACTGTGTCGCTTTGACTGAGGGCAAGGCTCAGCTTGTCGAGGGAAGTATC
ATCGGCAGTATCTTTGTCGGCATTTTATTCCTCCCTGGTTTGTCCATGTGCTTTGGTGCACTCAAACGCAAGACC
CAACGGTTCAATGTGAAATCAGCTGGTGTGACCTCGACGATGTTGTTGTTTGCGGTTATTGCTGCCTTTGGTCCC
ACCCTCTTCTATCAGGTTTATGGTAGTGTAAGTTTCACCTTCCTTTGCAAACGAACCTAAGTTGACTGGTGCATA
GCATGAGCTGAACTGCCACTCGTGTGTAAGTTCCCTCGATCCAGAGACTCGAGATTGCAGGCGCTGCTATTTCTC
ACAAACAGCGGCTGTCGATGATCAATTCTTTCAAAAAGCGGTACAGCCATATGCATGGATCGCCGCTGTTTTCTT
GTTCCTTTCATACGGCATCGGCCTATGGTTTACTCTTAGGACCCACGCTGCTCTTATCTGGGCATCAGAGATGGA
AGAAAAAAAGAATTCCCATCCCCATGCCCATGCCCATGCCACCCAATCTGCCCAAGAATCATTCTACGAGCCACG
GCACATGTTCCCAAATGGCCAGCCCGAAGCTTCTGGTGCCGCTTCTGGGTCCAAAGATTCGATCCGTGAATCTCA
GCTGTATAAGCGAATCTTAGGCCAGTCATTGAAGCATCTTGGCTTGGAGGACAATGACTCTGGCAATTGGGAAGG
GGCTGGAAGTGAAGCCGCAGACCTCAGGGGCAATTTCCCACACTTGGTGCCCCCCAATCCTAGCGGCGAGGACGG
TTACCCTGTGCCAAAGTTTGTCCGTAATATGGCCCAAGAAGACAACGAGCGTCTAGTACGCCAGTTCACCGAAGT
AGCAGCAACAGCAGCAACAGTGGCTGCTCGGGATACGGCTCGAAGTCGCAAGCCCAATGTACAACACCATCAAGC
CTCTGTTCGTCAATCTAGCCGCCCTGCTCCGGAGCGATCACGAAATACACCTGGGGAAGAGCTTGAAGATCTCGG
GTTGAGTGTGGAGCCCACTCATTCTAGCGGAGGACATGATGCACCTAATTGGAGCAAAGTTAAAAGCTCTGTCAT
TCTTCTTGGGGCAACTGTCCTCTATGCAGTGATTGCTGAAATTCTTGTCAACACGGTTGATGTTGTGCTAGAGAG
CGTGGATATTGATGAGAAATTCCTCGGCATTACTCTTTTCGCGTTGGTGCCAAATACGACGGAGTTCCTAGTACG
TTGGTCATTGAAGGCCCTATCTGAGGTGATTTTGCATTTGATATTCTTAGCTAACACACCTAACAGAACGCCATC
TCATTTGCCATGAACGGAAACATTGCATTATCTATGGAAATTGGGTCTGCCTATGCACTACAGGTCTGTCTATTG
CAGATTCCTGCTGTGGTATTCTTCAGCGCTTTCTATGGCCGCTCGCTAGACCCATCTGAGCTTGTCAGCCACTCA
TTCAAGTAAGATAGCTTTTTCGTTTTCTTTTCTTTTTTTTTTTTCATTATGTCTCCAATCGAAATGCTGTGGCTA
ACAAAATATTTCAACAGCCTAATATTCCCGCAGTGGGATATGATTACCGTTATTATGTGCGTCTTCCTTCTCTCG
CATGTATACGGCGAAGGAAAGAGCAACTACTTTAAGGGATCCATCCTTGTACTCACCTACCTCGTCGTTGTGCTT
GGCTTCCATATGTCAGGCTATGTGAATATGGACAGTATGGGCGTGGATCGCTTTGATACCCTAGCCATAGGCAGC
ACCAGTAGTTCCAACAAGTTCTACACTGTTGGCCGAACAAGAGGCGGGGTGGCCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail