Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g314.t1
Gene name
Locationscaffold_01:796610..797313
Strand+
Gene length (bp)703
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1065.34 606.49 1524.20
5d_25C Five days - 25 degrees Celsius 595.26 332.71 857.81
7d_25C Seven days - 25 degrees Celsius 521.16 286.04 756.29
10d_25C Ten days - 25 degrees Celsius 312.92 167.25 458.60
7d_15C Seven days - 15 degrees Celsius 469.46 185.10 753.82
7d_30C Seven days - 30 degrees Celsius 586.60 307.69 865.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.009446 yes
3d_25C 7d_25C 0.001804 yes
3d_25C 7d_15C 0.003197 yes
3d_25C 7d_30C 0.011062 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.671412 no
5d_25C 7d_15C 0.460452 no
5d_25C 7d_30C 0.971240 no
5d_25C 10d_25C 0.003197 yes
7d_25C 7d_15C 0.788925 no
7d_25C 7d_30C 0.722116 no
7d_25C 10d_25C 0.032612 yes
7d_15C 7d_30C 0.511419 no
7d_15C 10d_25C 0.177586 no
7d_30C 10d_25C 0.007091 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g314.t1
MRSSIIFLSALATAVMADNSTDTYTFPAGFNIGLVDSGTLSSWCSAQRNTCPDLCSSGTKLNSCDPTTLKFSCVC
SDGSTPNVTSYIQTVPFYVCQATYGQCINSHPNDAEGQRACKQASADCGSKNASAVTTTSSAAATSASATSTLAL
ATTTDSSTTATSSVAAASTTTNAAVALGDLTQYSTGLMAGLMFVAARMIL*
Coding >Pro_DTO377G3_2|g314.t1
ATGCGTTCCTCAATTATCTTCCTTTCAGCTCTGGCTACTGCTGTCATGGCTGACAATTCCACTGACACTTACACC
TTCCCCGCTGGCTTCAATATTGGTCTGGTGGATAGCGGCACCCTGAGCTCCTGGTGCTCTGCTCAGCGCAACACC
TGCCCCGATCTTTGCTCAAGTGGTACCAAGCTGAACTCTTGCGACCCGACCACCCTGAAGTTCAGCTGTGTCTGC
AGCGATGGTTCAACCCCAAATGTGACCTCCTACATTCAGACCGTTCCTTTCTACGTCTGCCAGGCTACTTACGGC
CAGTGCATCAACTCGCACCCCAACGATGCTGAGGGCCAGCGCGCCTGCAAGCAGGCATCGGCCGACTGTGGCTCC
AAGAACGCAAGTGCGGTGACCACCACCTCTTCTGCTGCTGCGACTTCGGCCAGCGCTACGAGCACTCTGGCATTG
GCCACTACGACCGATTCTTCCACCACTGCCACTTCCTCCGTCGCTGCTGCCAGCACTACCACCAACGCTGCTGTG
GCCCTCGGTGATCTGACCCAGTACTCCACTGGTCTGATGGCTGGTCTCATGTTCGTTGCTGCGCGCATGATCCTG
TAA
Transcript >Pro_DTO377G3_2|g314.t1
ATGCGTTCCTCAATTATCTTCCTTTCAGCTCTGGCTACTGCTGTCATGGCTGACAATTCCACTGACACTTACACC
TTCCCCGCTGGCTTCAATATTGGTCTGGTGGATAGCGGCACCCTGAGCTCCTGGTGCTCTGCTCAGCGCAACACC
TGCCCCGATCTTTGCTCAAGTGGTACCAAGCTGAACTCTTGCGACCCGACCACCCTGAAGTTCAGCTGTGTCTGC
AGCGATGGTTCAACCCCAAATGTGACCTCCTACATTCAGACCGTTCCTTTCTACGTCTGCCAGGCTACTTACGGC
CAGTGCATCAACTCGCACCCCAACGATGCTGAGGGCCAGCGCGCCTGCAAGCAGGCATCGGCCGACTGTGGCTCC
AAGAACGCAAGTGCGGTGACCACCACCTCTTCTGCTGCTGCGACTTCGGCCAGCGCTACGAGCACTCTGGCATTG
GCCACTACGACCGATTCTTCCACCACTGCCACTTCCTCCGTCGCTGCTGCCAGCACTACCACCAACGCTGCTGTG
GCCCTCGGTGATCTGACCCAGTACTCCACTGGTCTGATGGCTGGTCTCATGTTCGTTGCTGCGCGCATGATCCTG
TAA
Gene >Pro_DTO377G3_2|g314.t1
ATGCGTTCCTCAATTATCTTCCTTTCAGCTCTGGCTACTGCTGTCATGGCTGACAATTCCACTGACACTTACACC
TTCCCCGCTGGCTTCAATATTGGTCTGGTGGATAGCGGCACCCTGAGTATGTACCCCGACCAATTCTGACACGAC
GAAGCGCTAATGAAGTAGGCTCCTGGTGCTCTGCTCAGCGCAACACCTGCCCCGATCTTTGCTCAAGTGGTACCA
AGCTGAACTCTTGCGACCCGGTATGTTGTTGTGTATCGCGTCCATACGACCGGGAGATTAACGCTTTGAACAGAC
CACCCTGAAGTTCAGCTGTGTCTGCAGCGATGGTTCAACCCCAAATGTGACCTCCTACATTCAGACCGTTCCTTT
CTACGTCTGCCAGGCTACTTACGGCCAGTGCATCAACTCGCACCCCAACGATGCTGAGGGCCAGCGCGCCTGCAA
GCAGGCATCGGCCGACTGTGGCTCCAAGAACGCAAGTGCGGTGACCACCACCTCTTCTGCTGCTGCGACTTCGGC
CAGCGCTACGAGCACTCTGGCATTGGCCACTACGACCGATTCTTCCACCACTGCCACTTCCTCCGTCGCTGCTGC
CAGCACTACCACCAACGCTGCTGTGGCCCTCGGTGATCTGACCCAGTACTCCACTGGTCTGATGGCTGGTCTCAT
GTTCGTTGCTGCGCGCATGATCCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail