Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3139.t1
Gene name
Locationscaffold_04:808093..808582
Strand+
Gene length (bp)489
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14138 COX16 Cytochrome c oxidase assembly protein COX16 9.7E-30 38 128

GO

GO Term Description Terminal node
GO:0031966 mitochondrial membrane Yes
GO:0016020 membrane No
GO:0031090 organelle membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 102.10 48.77 155.42
5d_25C Five days - 25 degrees Celsius 126.16 63.69 188.62
7d_25C Seven days - 25 degrees Celsius 134.23 68.76 199.70
10d_25C Ten days - 25 degrees Celsius 159.15 84.99 233.31
7d_15C Seven days - 15 degrees Celsius 138.59 71.22 205.96
7d_30C Seven days - 30 degrees Celsius 115.80 56.97 174.63

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.530448 no
3d_25C 7d_25C 0.389431 no
3d_25C 7d_15C 0.318614 no
3d_25C 7d_30C 0.739918 no
3d_25C 10d_25C 0.105414 no
5d_25C 7d_25C 0.878487 no
5d_25C 7d_15C 0.801685 no
5d_25C 7d_30C 0.823457 no
5d_25C 10d_25C 0.443887 no
7d_25C 7d_15C 0.940850 no
7d_25C 7d_30C 0.671950 no
7d_25C 10d_25C 0.602677 no
7d_15C 7d_30C 0.594154 no
7d_15C 10d_25C 0.689065 no
7d_30C 10d_25C 0.266422 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3139.t1
MPVFQSKTFRRAATESSSLGERLGAFYRARLARHPFILFGLPFMAVIVAGSFALTPAAALRYERYDRKVKQLSQD
EAFDLGLKGPDGEEGIKRNPRRRIIGDEKEEYYRLMAKDLDQWEQKRVQRFKGEPDGRL*
Coding >Pro_DTO377G3_2|g3139.t1
ATGCCTGTGTTCCAATCCAAAACCTTTCGTCGGGCAGCTACGGAATCATCGTCCCTCGGCGAACGGCTCGGTGCG
TTCTACCGGGCGCGACTGGCTCGACACCCTTTCATTCTCTTCGGACTTCCATTCATGGCCGTTATTGTAGCCGGG
TCATTTGCCTTGACGCCTGCTGCTGCCCTACGGTACGAGCGGTATGACCGCAAAGTCAAGCAGCTCAGTCAAGAC
GAAGCATTTGATCTCGGACTTAAGGGTCCTGACGGGGAAGAGGGAATCAAACGCAACCCACGGAGGAGGATTATA
GGCGACGAAAAGGAAGAATACTACAGACTCATGGCCAAAGATCTCGATCAATGGGAGCAGAAGCGAGTACAGCGA
TTCAAAGGTGAACCGGATGGAAGGCTGTAA
Transcript >Pro_DTO377G3_2|g3139.t1
ATGCCTGTGTTCCAATCCAAAACCTTTCGTCGGGCAGCTACGGAATCATCGTCCCTCGGCGAACGGCTCGGTGCG
TTCTACCGGGCGCGACTGGCTCGACACCCTTTCATTCTCTTCGGACTTCCATTCATGGCCGTTATTGTAGCCGGG
TCATTTGCCTTGACGCCTGCTGCTGCCCTACGGTACGAGCGGTATGACCGCAAAGTCAAGCAGCTCAGTCAAGAC
GAAGCATTTGATCTCGGACTTAAGGGTCCTGACGGGGAAGAGGGAATCAAACGCAACCCACGGAGGAGGATTATA
GGCGACGAAAAGGAAGAATACTACAGACTCATGGCCAAAGATCTCGATCAATGGGAGCAGAAGCGAGTACAGCGA
TTCAAAGGTGAACCGGATGGAAGGCTGTAA
Gene >Pro_DTO377G3_2|g3139.t1
ATGCCTGTGTTCCAATCCAAAACCTTTCGTCGGGCAGCTACGGAATCATCGTCCCTCGGCGAACGGCTCGGTGCG
TTCTACCGGGCGCGACTGGCTCGACACCCTTTCATTCTCTTCGGACTTCCATTCATGGCCGTTATTGTAGCCGGG
TCATTTGCCTTGACGCCTGCTGCTGCCCTACGGTACGAGCGGTATGACCGCAAAGTCAAGCAGCTCAGTCAAGAC
GAAGCATTTGATCTCGGACTTAAGGGTCCTGACGGGGAAGAGGGAATCAAACGCAACCCACGGAGGAGGATTATA
GGCGACGAAAAGGAAGAATACTACGTATGTATTGTTTTATTGTTTAATTAATCCTGACTTTCTTGTCTGACATTT
GGACTGAATGCTGATTATTGTATACGCTTACAGAGACTCATGGCCAAAGATCTCGATCAATGGGAGCAGAAGCGA
GTACAGCGATTCAAAGGTGAACCGGATGGAAGGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail