Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3136.t1
Gene name
Locationscaffold_04:799926..801672
Strand-
Gene length (bp)1746
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.0E-06 145 197
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 7.1E-05 200 276
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 3.6E-09 279 329
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.8E-10 333 383
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 3.3E-07 387 440
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 4.5E-05 184 212
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 1.9E-06 316 343
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 2.4E-08 370 398

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3136.t1
MPPKKNTSKPVEASTETVKRSTRLRTSARQITMTKAETPVKESTKAAAKSTTKSIEKPTAKPTAKATAKSTTKST
TKPTATSTKSTAKPSKMATSTKLTSATKKRKADEDEEKPREIKRSRVAQPRQPKPKVKVIINEAPKTKLNVFVCG
EGSSGELGLGTAKNVIDVKRPRLNKLLSAEEVGVVQVAVGGMHCLALTHDNKIFSWGVNDQGALGRETEWDGGYK
DIENDSDSDSDDEDSGLNPRESIPTAIPVTAFPEGTVFVEVAAADSASFALTDDGLVYGWGTFRSNDGILGFDAS
SHVQTIPTLISSLKKIKHLTCGANHVLALNDQGRVYSWGSGQQNQLGRRIVERNRLNGLQPREFGLPKNIVHIGS
GSYHSFAVHATGKVYAWGLNSFGATALREGAGDDEAAIVHPTLVESLSDKNISQICGGAHHSIAIAGDGECLVWG
RLDGFQSGLKIDALSDDAVIKDERDRPRILIAPTPVPGIKAKVVAAASDHSLAIDSDGRAWSWGFSATYQTGQGT
QDDIEVATVIDNTATRGKKLNWAGAGGQFSVFTEPASA*
Coding >Pro_DTO377G3_2|g3136.t1
ATGCCTCCTAAGAAGAACACGTCCAAGCCCGTCGAGGCTTCAACCGAGACGGTAAAGAGAAGTACTCGACTACGC
ACCAGCGCCAGGCAGATCACTATGACAAAGGCCGAAACCCCCGTGAAAGAGTCTACAAAGGCAGCTGCAAAATCC
ACCACTAAGTCCATTGAAAAACCTACCGCAAAGCCGACTGCAAAGGCTACTGCAAAGTCCACTACAAAGTCCACT
ACGAAGCCGACTGCAACATCTACCAAGTCAACTGCGAAGCCAAGCAAAATGGCAACATCTACCAAATTGACCTCT
GCTACGAAGAAGCGCAAAGCTGATGAAGATGAGGAGAAACCTCGCGAAATCAAAAGATCTCGTGTCGCGCAACCC
CGTCAGCCAAAGCCGAAAGTCAAAGTTATCATCAACGAGGCCCCGAAAACTAAACTGAATGTATTCGTCTGTGGT
GAGGGTAGCTCTGGTGAGCTGGGGTTGGGCACAGCTAAGAATGTTATCGATGTGAAGCGCCCACGTTTGAATAAG
CTTCTGTCTGCCGAAGAAGTCGGAGTTGTACAGGTTGCTGTCGGTGGCATGCACTGTCTAGCTCTAACGCATGAC
AACAAGATATTCTCCTGGGGTGTGAACGATCAGGGTGCGCTCGGAAGAGAAACTGAATGGGACGGTGGATACAAG
GACATTGAGAACGACAGCGATTCCGATTCCGATGATGAAGACAGTGGATTAAACCCCCGGGAGTCTATTCCCACT
GCTATTCCCGTCACCGCTTTCCCCGAAGGCACTGTCTTCGTTGAAGTCGCCGCCGCCGATAGCGCAAGCTTTGCC
TTGACCGATGATGGTCTAGTCTATGGCTGGGGCACCTTCCGAAGCAACGATGGAATCCTCGGATTTGACGCGTCT
TCTCACGTTCAAACGATCCCAACTTTGATCTCGTCTTTGAAGAAGATCAAACACCTGACTTGCGGAGCTAATCAC
GTTCTTGCCCTGAACGACCAAGGTCGCGTCTACTCGTGGGGCTCAGGACAACAGAATCAGCTCGGTCGCAGGATC
GTGGAGCGCAACAGGCTGAATGGTCTTCAGCCCCGAGAGTTCGGTCTCCCTAAGAACATCGTCCACATCGGGAGT
GGCTCGTACCACTCGTTTGCTGTTCACGCCACTGGCAAGGTCTATGCCTGGGGATTGAATAGCTTCGGTGCAACC
GCCCTCCGCGAGGGCGCTGGCGACGATGAAGCTGCTATCGTGCATCCCACTCTTGTCGAATCACTTTCTGACAAA
AATATTTCACAAATCTGCGGCGGCGCTCATCATTCGATTGCCATTGCTGGCGATGGTGAATGCTTGGTTTGGGGC
CGTCTTGACGGTTTCCAAAGCGGCCTTAAGATCGATGCACTTTCCGATGACGCCGTTATCAAGGATGAGCGCGAT
CGCCCCCGTATCCTGATCGCGCCTACCCCTGTTCCGGGTATCAAGGCCAAGGTTGTGGCGGCTGCCTCGGATCAT
TCTCTCGCTATCGATTCCGATGGCCGTGCATGGTCATGGGGTTTCTCTGCTACCTATCAAACGGGACAAGGTACA
CAGGATGACATCGAGGTGGCTACTGTTATCGATAACACTGCTACTCGTGGAAAGAAATTGAACTGGGCGGGTGCC
GGTGGTCAGTTCTCTGTGTTCACGGAGCCTGCCAGCGCGTGA
Transcript >Pro_DTO377G3_2|g3136.t1
ATGCCTCCTAAGAAGAACACGTCCAAGCCCGTCGAGGCTTCAACCGAGACGGTAAAGAGAAGTACTCGACTACGC
ACCAGCGCCAGGCAGATCACTATGACAAAGGCCGAAACCCCCGTGAAAGAGTCTACAAAGGCAGCTGCAAAATCC
ACCACTAAGTCCATTGAAAAACCTACCGCAAAGCCGACTGCAAAGGCTACTGCAAAGTCCACTACAAAGTCCACT
ACGAAGCCGACTGCAACATCTACCAAGTCAACTGCGAAGCCAAGCAAAATGGCAACATCTACCAAATTGACCTCT
GCTACGAAGAAGCGCAAAGCTGATGAAGATGAGGAGAAACCTCGCGAAATCAAAAGATCTCGTGTCGCGCAACCC
CGTCAGCCAAAGCCGAAAGTCAAAGTTATCATCAACGAGGCCCCGAAAACTAAACTGAATGTATTCGTCTGTGGT
GAGGGTAGCTCTGGTGAGCTGGGGTTGGGCACAGCTAAGAATGTTATCGATGTGAAGCGCCCACGTTTGAATAAG
CTTCTGTCTGCCGAAGAAGTCGGAGTTGTACAGGTTGCTGTCGGTGGCATGCACTGTCTAGCTCTAACGCATGAC
AACAAGATATTCTCCTGGGGTGTGAACGATCAGGGTGCGCTCGGAAGAGAAACTGAATGGGACGGTGGATACAAG
GACATTGAGAACGACAGCGATTCCGATTCCGATGATGAAGACAGTGGATTAAACCCCCGGGAGTCTATTCCCACT
GCTATTCCCGTCACCGCTTTCCCCGAAGGCACTGTCTTCGTTGAAGTCGCCGCCGCCGATAGCGCAAGCTTTGCC
TTGACCGATGATGGTCTAGTCTATGGCTGGGGCACCTTCCGAAGCAACGATGGAATCCTCGGATTTGACGCGTCT
TCTCACGTTCAAACGATCCCAACTTTGATCTCGTCTTTGAAGAAGATCAAACACCTGACTTGCGGAGCTAATCAC
GTTCTTGCCCTGAACGACCAAGGTCGCGTCTACTCGTGGGGCTCAGGACAACAGAATCAGCTCGGTCGCAGGATC
GTGGAGCGCAACAGGCTGAATGGTCTTCAGCCCCGAGAGTTCGGTCTCCCTAAGAACATCGTCCACATCGGGAGT
GGCTCGTACCACTCGTTTGCTGTTCACGCCACTGGCAAGGTCTATGCCTGGGGATTGAATAGCTTCGGTGCAACC
GCCCTCCGCGAGGGCGCTGGCGACGATGAAGCTGCTATCGTGCATCCCACTCTTGTCGAATCACTTTCTGACAAA
AATATTTCACAAATCTGCGGCGGCGCTCATCATTCGATTGCCATTGCTGGCGATGGTGAATGCTTGGTTTGGGGC
CGTCTTGACGGTTTCCAAAGCGGCCTTAAGATCGATGCACTTTCCGATGACGCCGTTATCAAGGATGAGCGCGAT
CGCCCCCGTATCCTGATCGCGCCTACCCCTGTTCCGGGTATCAAGGCCAAGGTTGTGGCGGCTGCCTCGGATCAT
TCTCTCGCTATCGATTCCGATGGCCGTGCATGGTCATGGGGTTTCTCTGCTACCTATCAAACGGGACAAGGTACA
CAGGATGACATCGAGGTGGCTACTGTTATCGATAACACTGCTACTCGTGGAAAGAAATTGAACTGGGCGGGTGCC
GGTGGTCAGTTCTCTGTGTTCACGGAGCCTGCCAGCGCGTGA
Gene >Pro_DTO377G3_2|g3136.t1
ATGCCTCCTAAGAAGAACACGTCCAAGCCCGTCGAGGCTTCAACCGAGACGGTAAAGAGAAGTACTCGACTACGC
ACCAGCGCCAGGCAGATCACTATGACAAAGGCCGAAACCCCCGTGAAAGAGTCTACAAAGGCAGCTGCAAAATCC
ACCACTAAGTCCATTGAAAAACCTACCGCAAAGCCGACTGCAAAGGCTACTGCAAAGTCCACTACAAAGTCCACT
ACGAAGCCGACTGCAACATCTACCAAGTCAACTGCGAAGCCAAGCAAAATGGCAACATCTACCAAATTGACCTCT
GCTACGAAGAAGCGCAAAGCTGATGAAGATGAGGAGAAACCTCGCGAAATCAAAAGATCTCGTGTCGCGCAACCC
CGTCAGCCAAAGCCGAAAGTCAAAGTTATCATCAACGAGGCCCCGAAAACTAAACTGAATGTATTCGTCTGTGGT
GAGGGTAGCTCTGGTGAGCTGGGGTTGGGCACAGCTAAGAATGTTATCGATGTGAAGCGCCCACGTTTGAATAAG
CTTCTGTCTGCCGAAGAAGTCGGAGTTGTACAGGTTGCTGTCGGTGGCATGCACTGTCTAGCTCTAACGCATGAC
AACAAGATATTCTCCTGGGGTGTGAACGATCAGGGTGCGCTCGGAAGAGAAACTGAATGGGACGGTGGATACAAG
GACATTGAGAACGACAGCGATTCCGATTCCGATGATGAAGACAGTGGATTAAACCCCCGGGAGTCTATTCCCACT
GCTATTCCCGTCACCGCTTTCCCCGAAGGCACTGTCTTCGTTGAAGTCGCCGCCGCCGATAGCGCAAGCTTTGCC
TTGACCGATGATGGTCTAGTCTATGGCTGGGGCACCTTCCGAGTAAGACGAACTGACTGTTTTGAATTACTTTGC
TTTTACTGACAACGATTCTAGAGCAACGATGGAATCCTCGGATTTGACGCGTCTTCTCACGTTCAAACGATCCCA
ACTTTGATCTCGTCTTTGAAGAAGATCAAACACCTGACTTGCGGAGCTAATCACGTTCTTGCCCTGAACGACCAA
GGTCGCGTCTACTCGTGGGGCTCAGGACAACAGAATCAGCTCGGTCGCAGGATCGTGGAGCGCAACAGGCTGAAT
GGTCTTCAGCCCCGAGAGTTCGGTCTCCCTAAGAACATCGTCCACATCGGGAGTGGCTCGTACCACTCGTTTGCT
GTTCACGCCACTGGCAAGGTCTATGCCTGGGGATTGAATAGCTTCGGTGCAACCGCCCTCCGCGAGGGCGCTGGC
GACGATGAAGCTGCTATCGTGCATCCCACTCTTGTCGAATCACTTTCTGACAAAAATATTTCACAAATCTGCGGC
GGCGCTCATCATTCGATTGCCATTGCTGGCGATGGTGAATGCTTGGTTTGGGGCCGTCTTGACGGTTTCCAAAGC
GGCCTTAAGATCGATGCACTTTCCGATGACGCCGTTATCAAGGATGAGCGCGATCGCCCCCGTATCCTGATCGCG
CCTACCCCTGTTCCGGGTATCAAGGCCAAGGTTGTGGCGGCTGCCTCGGATCATTCTCTCGCTATCGATTCCGAT
GGCCGTGCATGGTCATGGGGTTTCTCTGCTACCTATCAAACGGGACAAGGTACACAGGATGACATCGAGGTGGCT
ACTGTTATCGATAACACTGCTACTCGTGGAAAGAAATTGAACTGGGCGGGTGCCGGTGGTCAGTTCTCTGTGTTC
ACGGAGCCTGCCAGCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail