Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3118.t1
Gene name
Locationscaffold_04:739095..740262
Strand-
Gene length (bp)1167
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 9.2E-07 14 151

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 93.32 55.93 130.72
5d_25C Five days - 25 degrees Celsius 137.20 83.49 190.91
7d_25C Seven days - 25 degrees Celsius 143.43 86.90 199.96
10d_25C Ten days - 25 degrees Celsius 150.34 91.68 209.00
7d_15C Seven days - 15 degrees Celsius 120.55 71.54 169.56
7d_30C Seven days - 30 degrees Celsius 128.85 77.42 180.29

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.072817 no
3d_25C 7d_25C 0.041989 yes
3d_25C 7d_15C 0.293174 no
3d_25C 7d_30C 0.153271 no
3d_25C 10d_25C 0.018838 yes
5d_25C 7d_25C 0.892539 no
5d_25C 7d_15C 0.643655 no
5d_25C 7d_30C 0.843091 no
5d_25C 10d_25C 0.753825 no
7d_25C 7d_15C 0.509929 no
7d_25C 7d_30C 0.714949 no
7d_25C 10d_25C 0.885908 no
7d_15C 7d_30C 0.835860 no
7d_15C 10d_25C 0.378191 no
7d_30C 10d_25C 0.566882 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3118.t1
MSSPKRDSEPAVSRPSSSVLLISSKNEVLLLHRVKTSTSFASAHVFPGGNLSNQDGECPPPGDLARHEDSPSYRR
AAIRELFEESGILLAKDRSSGKMLAVDEPTREAGRRLIHQNKTTFDEWLKQQSADAEPDIGQLIPFTRWVTPTNI
PKRYTTQMYLYFLPLPVNVDKKILDQLPAEGEHEEHQIPTSDGGIEVTEAQFLPASEWVSRAQKAEIILFPPQFL
LLHLVSGFLDREPRADASVEEMEKRRQALVEFVHSGSPPWTEKCISPKSILMTSDGRSVLGLNEPGHELKGSSKR
GESERVVLVRFKKGSAREVAVGWKKDVLKKEREKSNL*
Coding >Pro_DTO377G3_2|g3118.t1
ATGTCGAGCCCGAAACGTGATAGTGAACCCGCAGTGTCCCGGCCTAGTTCTAGCGTTCTTCTTATATCTTCAAAG
AACGAGGTCCTTCTTCTTCATCGCGTGAAGACCTCTACCTCTTTTGCATCTGCACATGTCTTTCCTGGTGGCAAC
TTGTCTAATCAAGATGGGGAATGCCCACCACCCGGAGATCTAGCACGGCATGAAGATTCCCCAAGTTACCGACGT
GCAGCGATCAGGGAACTCTTTGAAGAGAGTGGAATTCTTCTAGCTAAAGACCGCAGCTCCGGGAAGATGCTTGCC
GTCGACGAACCTACCCGAGAGGCCGGCAGACGACTCATTCATCAGAACAAGACCACTTTTGATGAATGGTTGAAG
CAGCAAAGCGCTGATGCTGAGCCCGATATAGGCCAATTAATCCCTTTTACTCGCTGGGTTACGCCAACCAACATT
CCTAAGCGATACACTACTCAGATGTATCTATATTTCTTACCTTTACCCGTCAACGTGGATAAGAAAATCCTCGAC
CAACTCCCAGCAGAAGGCGAACACGAGGAGCATCAAATCCCAACGAGTGATGGTGGAATCGAGGTTACGGAGGCA
CAGTTTCTTCCCGCCTCGGAATGGGTTAGTCGTGCTCAAAAGGCTGAAATTATTCTATTCCCGCCGCAGTTCCTT
CTTTTACATTTGGTGTCAGGATTCCTGGACAGAGAGCCTCGTGCAGATGCTTCCGTGGAAGAAATGGAGAAGCGT
CGTCAAGCGCTTGTCGAGTTCGTTCATTCTGGCTCTCCTCCATGGACAGAGAAGTGCATATCCCCAAAATCTATT
CTCATGACCAGTGATGGGCGATCTGTGTTGGGTCTGAATGAACCCGGGCATGAGCTGAAAGGGTCTTCTAAGCGA
GGAGAGTCCGAGAGAGTGGTTCTTGTGCGGTTCAAAAAAGGAAGTGCACGAGAGGTGGCTGTTGGATGGAAAAAG
GACGTGTTGAAAAAAGAGAGGGAAAAGAGTAACCTGTAA
Transcript >Pro_DTO377G3_2|g3118.t1
ATGTCGAGCCCGAAACGTGATAGTGAACCCGCAGTGTCCCGGCCTAGTTCTAGCGTTCTTCTTATATCTTCAAAG
AACGAGGTCCTTCTTCTTCATCGCGTGAAGACCTCTACCTCTTTTGCATCTGCACATGTCTTTCCTGGTGGCAAC
TTGTCTAATCAAGATGGGGAATGCCCACCACCCGGAGATCTAGCACGGCATGAAGATTCCCCAAGTTACCGACGT
GCAGCGATCAGGGAACTCTTTGAAGAGAGTGGAATTCTTCTAGCTAAAGACCGCAGCTCCGGGAAGATGCTTGCC
GTCGACGAACCTACCCGAGAGGCCGGCAGACGACTCATTCATCAGAACAAGACCACTTTTGATGAATGGTTGAAG
CAGCAAAGCGCTGATGCTGAGCCCGATATAGGCCAATTAATCCCTTTTACTCGCTGGGTTACGCCAACCAACATT
CCTAAGCGATACACTACTCAGATGTATCTATATTTCTTACCTTTACCCGTCAACGTGGATAAGAAAATCCTCGAC
CAACTCCCAGCAGAAGGCGAACACGAGGAGCATCAAATCCCAACGAGTGATGGTGGAATCGAGGTTACGGAGGCA
CAGTTTCTTCCCGCCTCGGAATGGGTTAGTCGTGCTCAAAAGGCTGAAATTATTCTATTCCCGCCGCAGTTCCTT
CTTTTACATTTGGTGTCAGGATTCCTGGACAGAGAGCCTCGTGCAGATGCTTCCGTGGAAGAAATGGAGAAGCGT
CGTCAAGCGCTTGTCGAGTTCGTTCATTCTGGCTCTCCTCCATGGACAGAGAAGTGCATATCCCCAAAATCTATT
CTCATGACCAGTGATGGGCGATCTGTGTTGGGTCTGAATGAACCCGGGCATGAGCTGAAAGGGTCTTCTAAGCGA
GGAGAGTCCGAGAGAGTGGTTCTTGTGCGGTTCAAAAAAGGAAGTGCACGAGAGGTGGCTGTTGGATGGAAAAAG
GACGTGTTGAAAAAAGAGAGGGAAAAGAGTAACCTGTAA
Gene >Pro_DTO377G3_2|g3118.t1
ATGTCGAGCCCGAAACGTGATAGTGAACCCGCAGTGTCCCGGCCTAGTTCTAGGTAAGCGCAAGGGACCACATGA
CACATTGACTAGGGAGATATTCACGGCGCGATGTCAGGCATTCCCCCAAAAAAGAATTGGGTACTAACTATTATA
TAGCGTTCTTCTTATATCTTCAAAGAACGAGGTCCTTCTTCTTCATCGCGTGAAGACCTCTACCTCTTTTGCATC
TGCACATGTCTTTCCTGGTGGCAACTTGTCTAATCAAGATGGGGAATGCCCACCACCCGGAGATCTAGCACGGCA
TGAAGATTCCCCAAGTTACCGACGTGCAGCGATCAGGGAACTCTTTGAAGAGAGTGGAATTCTTCTAGCTAAAGA
CCGCAGCTCCGGGAAGATGCTTGCCGTCGACGAACCTACCCGAGAGGCCGGCAGACGACTCATTCATCAGAACAA
GACCACTTTTGATGAATGGTTGAAGCAGCAAAGCGCTGATGCTGAGCCCGATATAGGTAAGTGCCCATTCTGCGC
ATTGACACCCGAGGGCAGCACGCTGACTCTACAGGCCAATTAATCCCTTTTACTCGCTGGGTTACGCCAACCAAC
ATTCCTAAGCGATACACTACTCAGATGTATCTATATTTCTTACCTTTACCCGTCAACGTGGATAAGAAAATCCTC
GACCAACTCCCAGCAGAAGGCGAACACGAGGAGCATCAAATCCCAACGAGTGATGGTGGAATCGAGGTTACGGAG
GCACAGTTTCTTCCCGCCTCGGAATGGGTTAGTCGTGCTCAAAAGGCTGAAATTATTCTATTCCCGCCGCAGTTC
CTTCTTTTACATTTGGTGTCAGGATTCCTGGACAGAGAGCCTCGTGCAGATGCTTCCGTGGAAGAAATGGAGAAG
CGTCGTCAAGCGCTTGTCGAGTTCGTTCATTCTGGCTCTCCTCCATGGACAGAGAAGTGCATATCCCCAAAATCT
ATTCTCATGACCAGTGATGGGCGATCTGTGTTGGGTCTGAATGAACCCGGGCATGAGCTGAAAGGGTCTTCTAAG
CGAGGAGAGTCCGAGAGAGTGGTTCTTGTGCGGTTCAAAAAAGGAAGTGCACGAGAGGTGGCTGTTGGATGGAAA
AAGGACGTGTTGAAAAAAGAGAGGGAAAAGAGTAACCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail