Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3114.t1
Gene name
Locationscaffold_04:727818..728458
Strand+
Gene length (bp)640
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01246 Ribosomal_L24e Ribosomal protein L24e 4.3E-27 1 64

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 131.15 75.63 186.67
5d_25C Five days - 25 degrees Celsius 100.38 55.13 145.62
7d_25C Seven days - 25 degrees Celsius 100.33 55.00 145.66
10d_25C Ten days - 25 degrees Celsius 71.71 36.14 107.29
7d_15C Seven days - 15 degrees Celsius 97.55 53.36 141.74
7d_30C Seven days - 30 degrees Celsius 105.40 58.08 152.72

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.299168 no
3d_25C 7d_25C 0.293757 no
3d_25C 7d_15C 0.238765 no
3d_25C 7d_30C 0.427906 no
3d_25C 10d_25C 0.009124 yes
5d_25C 7d_25C 0.998927 no
5d_25C 7d_15C 0.940482 no
5d_25C 7d_30C 0.897251 no
5d_25C 10d_25C 0.218725 no
7d_25C 7d_15C 0.942722 no
7d_25C 7d_30C 0.898226 no
7d_25C 10d_25C 0.216893 no
7d_15C 7d_30C 0.827719 no
7d_15C 10d_25C 0.266324 no
7d_30C 10d_25C 0.142155 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3114.t1
MRVETCHFCSRPAFPSKGITFVRNDARQFRFCRSKCHKNFKMKRQPRKLKWTKTHRASRGKEMIVDSSLVLSQFA
KKRNVPVKYDRNLMAATITAMERVEEIRARRERVFTKRRLAGKTSRERQREADRKVVNEGEHLIRKELREREEGL
PMVAEQSKVSNRVHGEERVRQKQKSKLLVDGGVEEQMDID*
Coding >Pro_DTO377G3_2|g3114.t1
ATGCGTGTTGAAACTTGTCACTTCTGTTCCCGCCCGGCTTTCCCGAGTAAGGGAATCACATTCGTCCGCAACGAT
GCCCGACAATTTCGTTTCTGTCGGTCCAAGTGCCACAAGAACTTCAAGATGAAGCGTCAGCCCCGCAAGCTTAAG
TGGACCAAGACTCACCGTGCCTCCCGCGGAAAGGAAATGATCGTGGATTCGTCGCTTGTTCTGTCCCAGTTCGCC
AAGAAGAGAAACGTCCCCGTCAAGTACGACCGCAATCTCATGGCTGCTACCATCACTGCCATGGAGAGAGTCGAG
GAGATCAGAGCCCGCCGCGAGCGTGTATTCACGAAACGCCGCCTGGCCGGAAAAACCTCCCGCGAGCGCCAGCGC
GAGGCGGACCGCAAGGTCGTCAACGAGGGCGAGCACCTCATCCGGAAGGAACTCCGGGAGCGCGAGGAGGGTCTC
CCCATGGTGGCCGAGCAGAGCAAGGTTTCCAACAGAGTTCACGGCGAGGAGAGAGTTCGCCAGAAGCAGAAGAGC
AAGCTTTTGGTGGATGGTGGAGTGGAGGAGCAGATGGATATCGACTAA
Transcript >Pro_DTO377G3_2|g3114.t1
ATGCGTGTTGAAACTTGTCACTTCTGTTCCCGCCCGGCTTTCCCGAGTAAGGGAATCACATTCGTCCGCAACGAT
GCCCGACAATTTCGTTTCTGTCGGTCCAAGTGCCACAAGAACTTCAAGATGAAGCGTCAGCCCCGCAAGCTTAAG
TGGACCAAGACTCACCGTGCCTCCCGCGGAAAGGAAATGATCGTGGATTCGTCGCTTGTTCTGTCCCAGTTCGCC
AAGAAGAGAAACGTCCCCGTCAAGTACGACCGCAATCTCATGGCTGCTACCATCACTGCCATGGAGAGAGTCGAG
GAGATCAGAGCCCGCCGCGAGCGTGTATTCACGAAACGCCGCCTGGCCGGAAAAACCTCCCGCGAGCGCCAGCGC
GAGGCGGACCGCAAGGTCGTCAACGAGGGCGAGCACCTCATCCGGAAGGAACTCCGGGAGCGCGAGGAGGGTCTC
CCCATGGTGGCCGAGCAGAGCAAGGTTTCCAACAGAGTTCACGGCGAGGAGAGAGTTCGCCAGAAGCAGAAGAGC
AAGCTTTTGGTGGATGGTGGAGTGGAGGAGCAGATGGATATCGACTAA
Gene >Pro_DTO377G3_2|g3114.t1
ATGCGGTAAGTTTTGCCGTTAATTTTTGTCTCTATCCGTTCTACGGAATGCTAATATCATTTTCATCTGCAGTGT
TGAAACTTGTCACTTCTGTTCCCGCCCGGCTTTCCCGAGTAAGGGAATCACATTCGTCCGCAACGATGCCCGACA
ATTTCGTTTCTGTCGGTCCAAGTGCCACAAGAACTTCAAGATGAAGCGTCAGCCCCGCAAGCTTAAGTGGACCAA
GACTCACCGTGCCTCCCGCGGAAAGGAAATGATCGTGGATTCGTCGCTTGTTCTGTCCCAGTTCGCCAAGAAGAG
AAACGTCCCCGTCAAGTACGACCGCAATCTCATGGCTGCTACCATCACTGCCATGGAGAGAGTCGAGGAGATCAG
AGCCCGCCGCGAGCGTGTATTCACGAAACGCCGCCTGGCCGGAAAAACCTCCCGCGAGCGCCAGCGCGAGGCGGA
CCGCAAGGTCGTCAACGAGGGCGAGCACCTCATCCGGAAGGAACTCCGGGAGCGCGAGGAGGGTCTCCCCATGGT
GGCCGAGCAGAGCAAGGTTTCCAACAGAGTTCACGGCGAGGAGAGAGTTCGCCAGAAGCAGAAGAGCAAGCTTTT
GGTGGATGGTGGAGTGGAGGAGCAGATGGATATCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail