Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3111.t1
Gene name
Locationscaffold_04:719765..722586
Strand-
Gene length (bp)2821
Transcript length (bp)2763
Coding sequence length (bp)2763
Protein length (aa) 921

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01434 Peptidase_M41 Peptidase family M41 3.3E-65 688 870
PF00004 AAA ATPase family associated with various cellular activities (AAA) 5.0E-42 472 604
PF06480 FtsH_ext FtsH Extracellular 4.7E-12 268 367
PF17862 AAA_lid_3 AAA+ lid domain 3.8E-12 634 672

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006508 proteolysis Yes
GO:0008270 zinc ion binding Yes
GO:0016021 integral component of membrane Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0046914 transition metal ion binding No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043170 macromolecule metabolic process No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0044425 membrane part No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0008233 peptidase activity No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0004175 endopeptidase activity No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0030554 adenyl nucleotide binding No
GO:0043169 cation binding No
GO:0008237 metallopeptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3111.t1
MATLLRRPGNFARYLRKAADSTGRTGLASMRVRPSRPSHLGLSSRARTYATQGPTPPNDNGRDNTPDGRNNDHQT
KNPKSLLTDAELKMVDAWLEDMDVDRRTNIRNYIMKNGLLPEVRAYIDPNQEPTLMDRIKMSRFLWQVSTYDVDE
RLARQAQNAKRGIADLRTPAEKRSDMAKRDEESSVHFNKDSEKDQQGQQPAKGGEQQSNAQPPNDPKDPKDPKKE
KDTKEKQDSEKEEEKKKQQGDKKGKVPPNMGKVLEFRFDPVSFFVTALVTYYAYRSFFPGDSAGREITWQEFRAN
YLEKGLVDKLTVLNHTKVRVDLNREAAAQADSNGQPASYVYFSIGSVDSFEMKIDAAQRELGIPSHERIPVAYHD
ETPWGGVLMSLAPTILFLGGVFWMSRRAGGGAGGQSGIFGIGKSRAKRFNHETDIKIKFSDVAGMDEAKVEIMEF
VSFLQQPERFEKLGAKIPRGAILSGPPGTGKTLLAKATAGESGVPFYSVSGSEFVEMFVGVGPSRVRDLFATARK
NTPCIIFIDEIDAIGKSRAKSNVGGGNDERESTLNQILTEMDGFNTSEQVVVLAGTNRPDVLDKALMRPGRFDRH
ISIDRPTMDGRKQIFRVYLKKIVTDENLEYMEGRLAALTPGFAGADIANCVNEAALVAARENADKVVMRHFEQAI
ERVVGGLEKKSLVLSPEEKRTVAYHEAGHAICGWYFKWADPLLKVSIIPRGQGALGYAQYLPAGGDTYLMNVNQM
MDRMAMTLGGRVSEELHFDSVTSGASDDFNKVTRMATAMVTKFGMSSKLGFIYYEDDAQQQLHKPFSEDTARSID
LEVRRIIDEAHKQCRDLLTEKRTELGIVAEELLSKEVLGRDDLIRLLGPRPYPESGEFAKYFDGTGGQTIAPSDH
QSPEETSGNNGRDETPIPPP*
Coding >Pro_DTO377G3_2|g3111.t1
ATGGCTACTCTGCTCCGACGGCCAGGCAATTTCGCTCGCTACTTGAGGAAAGCCGCGGATTCAACCGGTCGCACG
GGGCTGGCTTCTATGCGTGTGCGCCCGTCAAGACCCTCACATCTGGGTTTATCAAGCCGCGCTAGAACCTACGCC
ACGCAAGGTCCGACACCACCCAACGACAACGGCCGGGACAATACACCAGATGGCCGCAACAATGACCACCAAACA
AAGAACCCGAAGTCACTTCTGACCGACGCTGAATTGAAAATGGTGGATGCATGGCTTGAAGATATGGATGTGGAC
CGACGGACCAATATCCGAAACTACATCATGAAAAATGGACTGTTACCGGAAGTCAGGGCGTATATCGATCCGAAT
CAAGAACCGACATTAATGGATCGTATCAAGATGTCGCGATTCTTGTGGCAAGTCTCAACTTACGATGTTGATGAG
CGTCTGGCTAGACAAGCACAAAACGCAAAGCGCGGTATCGCAGACTTGCGCACCCCCGCTGAAAAGCGCAGTGAT
ATGGCCAAACGTGACGAAGAATCCAGCGTCCACTTCAATAAGGACTCAGAGAAGGATCAACAAGGACAGCAACCG
GCGAAGGGTGGCGAACAGCAATCCAACGCACAACCGCCAAACGATCCCAAGGATCCCAAGGATCCTAAGAAGGAA
AAGGATACCAAGGAAAAGCAAGATTCCGAGAAGGAAGAAGAGAAGAAGAAGCAACAGGGTGACAAGAAGGGCAAG
GTGCCGCCGAACATGGGCAAGGTTCTCGAGTTCCGCTTTGATCCCGTTTCGTTCTTCGTTACCGCTCTCGTCACA
TACTACGCCTACCGCAGCTTTTTCCCCGGTGATAGTGCGGGTAGAGAAATCACTTGGCAAGAATTCAGGGCGAAC
TACCTCGAGAAGGGCCTCGTGGATAAATTGACCGTCCTGAACCACACCAAGGTTCGGGTCGATCTCAACCGCGAA
GCTGCCGCTCAAGCAGATTCAAATGGTCAGCCTGCCTCCTATGTCTACTTTAGTATTGGTTCCGTCGACAGCTTC
GAAATGAAGATCGACGCAGCTCAGCGTGAACTCGGTATTCCCTCGCATGAACGTATTCCTGTCGCCTATCACGAT
GAAACCCCATGGGGCGGCGTCTTGATGTCATTGGCTCCTACTATCCTCTTCCTTGGTGGTGTCTTCTGGATGTCT
CGACGTGCTGGCGGCGGCGCCGGCGGCCAAAGTGGAATCTTTGGCATCGGAAAGAGCCGTGCCAAACGCTTCAAC
CACGAGACCGATATCAAGATCAAGTTCTCTGACGTTGCTGGTATGGACGAAGCCAAGGTTGAGATCATGGAATTC
GTTAGCTTCCTCCAGCAACCCGAGCGGTTCGAGAAGTTGGGTGCAAAGATTCCTCGTGGTGCCATTCTCTCAGGT
CCCCCCGGTACTGGTAAGACATTGCTTGCTAAGGCCACTGCTGGTGAATCCGGCGTGCCTTTCTACAGTGTCAGT
GGTTCCGAGTTTGTCGAAATGTTTGTCGGTGTCGGACCCTCTCGTGTCCGCGATCTCTTCGCAACCGCCCGGAAG
AATACCCCCTGCATCATCTTCATTGATGAAATTGATGCGATTGGAAAGTCTCGAGCAAAGTCGAACGTTGGTGGT
GGAAACGATGAACGTGAAAGCACTCTCAACCAGATTCTCACTGAGATGGATGGTTTCAATACCTCTGAGCAAGTG
GTTGTCTTGGCTGGTACCAATCGACCGGATGTTCTTGACAAGGCACTCATGCGTCCCGGACGATTTGACCGACAC
ATCTCCATTGACCGACCTACCATGGATGGTCGTAAACAGATCTTCCGGGTTTACTTGAAGAAGATTGTCACCGAC
GAGAACTTGGAGTACATGGAGGGCAGACTTGCCGCTCTGACTCCTGGTTTCGCTGGTGCTGATATCGCCAACTGC
GTGAACGAGGCAGCTCTTGTTGCTGCCCGTGAAAATGCCGACAAGGTTGTCATGAGACATTTCGAGCAAGCCATC
GAACGGGTTGTTGGTGGATTGGAAAAGAAGTCTCTTGTGCTCTCCCCTGAGGAGAAGCGGACCGTCGCCTACCAC
GAGGCTGGCCACGCTATCTGTGGTTGGTACTTCAAGTGGGCTGATCCGCTGCTGAAGGTTTCGATCATTCCTCGC
GGACAAGGCGCACTAGGATATGCCCAATACCTGCCAGCTGGCGGCGACACATATCTGATGAACGTCAACCAGATG
ATGGACCGCATGGCCATGACTCTAGGTGGTCGTGTCAGCGAAGAGTTGCACTTCGATTCCGTGACCAGTGGTGCT
AGTGATGATTTCAACAAGGTCACCCGCATGGCTACTGCCATGGTAACTAAGTTTGGCATGTCGTCCAAGCTTGGT
TTCATCTACTACGAGGATGACGCACAGCAGCAACTTCACAAGCCCTTCTCGGAGGACACTGCCCGCTCTATTGAT
CTGGAGGTGCGCCGTATCATCGACGAGGCTCACAAGCAGTGCCGCGACCTCCTGACCGAGAAGCGGACGGAGCTT
GGTATTGTTGCCGAGGAGCTTCTTTCTAAAGAGGTTCTTGGACGTGATGACCTCATTCGTCTTCTTGGCCCGCGC
CCCTACCCCGAGTCTGGCGAGTTCGCCAAGTACTTCGATGGCACAGGCGGCCAGACCATTGCCCCATCGGACCAC
CAGAGCCCCGAAGAAACTTCCGGTAACAACGGCCGGGACGAGACACCTATTCCTCCTCCATAG
Transcript >Pro_DTO377G3_2|g3111.t1
ATGGCTACTCTGCTCCGACGGCCAGGCAATTTCGCTCGCTACTTGAGGAAAGCCGCGGATTCAACCGGTCGCACG
GGGCTGGCTTCTATGCGTGTGCGCCCGTCAAGACCCTCACATCTGGGTTTATCAAGCCGCGCTAGAACCTACGCC
ACGCAAGGTCCGACACCACCCAACGACAACGGCCGGGACAATACACCAGATGGCCGCAACAATGACCACCAAACA
AAGAACCCGAAGTCACTTCTGACCGACGCTGAATTGAAAATGGTGGATGCATGGCTTGAAGATATGGATGTGGAC
CGACGGACCAATATCCGAAACTACATCATGAAAAATGGACTGTTACCGGAAGTCAGGGCGTATATCGATCCGAAT
CAAGAACCGACATTAATGGATCGTATCAAGATGTCGCGATTCTTGTGGCAAGTCTCAACTTACGATGTTGATGAG
CGTCTGGCTAGACAAGCACAAAACGCAAAGCGCGGTATCGCAGACTTGCGCACCCCCGCTGAAAAGCGCAGTGAT
ATGGCCAAACGTGACGAAGAATCCAGCGTCCACTTCAATAAGGACTCAGAGAAGGATCAACAAGGACAGCAACCG
GCGAAGGGTGGCGAACAGCAATCCAACGCACAACCGCCAAACGATCCCAAGGATCCCAAGGATCCTAAGAAGGAA
AAGGATACCAAGGAAAAGCAAGATTCCGAGAAGGAAGAAGAGAAGAAGAAGCAACAGGGTGACAAGAAGGGCAAG
GTGCCGCCGAACATGGGCAAGGTTCTCGAGTTCCGCTTTGATCCCGTTTCGTTCTTCGTTACCGCTCTCGTCACA
TACTACGCCTACCGCAGCTTTTTCCCCGGTGATAGTGCGGGTAGAGAAATCACTTGGCAAGAATTCAGGGCGAAC
TACCTCGAGAAGGGCCTCGTGGATAAATTGACCGTCCTGAACCACACCAAGGTTCGGGTCGATCTCAACCGCGAA
GCTGCCGCTCAAGCAGATTCAAATGGTCAGCCTGCCTCCTATGTCTACTTTAGTATTGGTTCCGTCGACAGCTTC
GAAATGAAGATCGACGCAGCTCAGCGTGAACTCGGTATTCCCTCGCATGAACGTATTCCTGTCGCCTATCACGAT
GAAACCCCATGGGGCGGCGTCTTGATGTCATTGGCTCCTACTATCCTCTTCCTTGGTGGTGTCTTCTGGATGTCT
CGACGTGCTGGCGGCGGCGCCGGCGGCCAAAGTGGAATCTTTGGCATCGGAAAGAGCCGTGCCAAACGCTTCAAC
CACGAGACCGATATCAAGATCAAGTTCTCTGACGTTGCTGGTATGGACGAAGCCAAGGTTGAGATCATGGAATTC
GTTAGCTTCCTCCAGCAACCCGAGCGGTTCGAGAAGTTGGGTGCAAAGATTCCTCGTGGTGCCATTCTCTCAGGT
CCCCCCGGTACTGGTAAGACATTGCTTGCTAAGGCCACTGCTGGTGAATCCGGCGTGCCTTTCTACAGTGTCAGT
GGTTCCGAGTTTGTCGAAATGTTTGTCGGTGTCGGACCCTCTCGTGTCCGCGATCTCTTCGCAACCGCCCGGAAG
AATACCCCCTGCATCATCTTCATTGATGAAATTGATGCGATTGGAAAGTCTCGAGCAAAGTCGAACGTTGGTGGT
GGAAACGATGAACGTGAAAGCACTCTCAACCAGATTCTCACTGAGATGGATGGTTTCAATACCTCTGAGCAAGTG
GTTGTCTTGGCTGGTACCAATCGACCGGATGTTCTTGACAAGGCACTCATGCGTCCCGGACGATTTGACCGACAC
ATCTCCATTGACCGACCTACCATGGATGGTCGTAAACAGATCTTCCGGGTTTACTTGAAGAAGATTGTCACCGAC
GAGAACTTGGAGTACATGGAGGGCAGACTTGCCGCTCTGACTCCTGGTTTCGCTGGTGCTGATATCGCCAACTGC
GTGAACGAGGCAGCTCTTGTTGCTGCCCGTGAAAATGCCGACAAGGTTGTCATGAGACATTTCGAGCAAGCCATC
GAACGGGTTGTTGGTGGATTGGAAAAGAAGTCTCTTGTGCTCTCCCCTGAGGAGAAGCGGACCGTCGCCTACCAC
GAGGCTGGCCACGCTATCTGTGGTTGGTACTTCAAGTGGGCTGATCCGCTGCTGAAGGTTTCGATCATTCCTCGC
GGACAAGGCGCACTAGGATATGCCCAATACCTGCCAGCTGGCGGCGACACATATCTGATGAACGTCAACCAGATG
ATGGACCGCATGGCCATGACTCTAGGTGGTCGTGTCAGCGAAGAGTTGCACTTCGATTCCGTGACCAGTGGTGCT
AGTGATGATTTCAACAAGGTCACCCGCATGGCTACTGCCATGGTAACTAAGTTTGGCATGTCGTCCAAGCTTGGT
TTCATCTACTACGAGGATGACGCACAGCAGCAACTTCACAAGCCCTTCTCGGAGGACACTGCCCGCTCTATTGAT
CTGGAGGTGCGCCGTATCATCGACGAGGCTCACAAGCAGTGCCGCGACCTCCTGACCGAGAAGCGGACGGAGCTT
GGTATTGTTGCCGAGGAGCTTCTTTCTAAAGAGGTTCTTGGACGTGATGACCTCATTCGTCTTCTTGGCCCGCGC
CCCTACCCCGAGTCTGGCGAGTTCGCCAAGTACTTCGATGGCACAGGCGGCCAGACCATTGCCCCATCGGACCAC
CAGAGCCCCGAAGAAACTTCCGGTAACAACGGCCGGGACGAGACACCTATTCCTCCTCCATAG
Gene >Pro_DTO377G3_2|g3111.t1
ATGGCTACTCTGCTCCGACGGCCAGGCAATTTCGCTCGCTACTTGAGGAAAGCCGCGGATTCAACCGGTCGCACG
GGGCTGGCTTCTATGCGTGTGCGCCCGTCAAGACCCTCACATCTGGGTTTATCAAGCCGCGCTAGAACCTACGCC
ACGCAAGGTCCGACACCACCCAACGACAACGGCCGGGACAATACACCAGATGGCCGCAACAATGACCACCAAACA
AAGAACCCGAAGTCACTTCTGACCGACGCTGAATTGAAAATGGTGGATGCATGGCTTGAAGATATGGATGTGGAC
CGACGGACCAATATCCGAAACTACATCATGAAAAATGGACTGTTACCGGAAGTCAGGGCGTATATCGATCCGAAT
CAAGAACCGACATTAATGGATCGTATCAAGATGTCGCGATTCTTGTGGCAAGTCTCAACTTACGATGTTGATGAG
CGTCTGGCTAGACAAGCACAAAACGCAAAGCGCGGTATCGCAGACTTGCGCACCCCCGCTGAAAAGCGCAGTGAT
ATGGCCAAACGTGACGAAGAATCCAGCGTCCACTTCAATAAGGACTCAGAGAAGGATCAACAAGGACAGCAACCG
GCGAAGGGTGGCGAACAGCAATCCAACGCACAACCGCCAAACGATCCCAAGGATCCCAAGGATCCTAAGAAGGAA
AAGGATACCAAGGAAAAGCAAGATTCCGAGAAGGAAGAAGAGAAGAAGAAGCAACAGGGTGACAAGAAGGGCAAG
GTGCCGCCGAACATGGGCAAGGTTCTCGAGTTCCGCTTTGATCCCGTTTCGTTCTTCGTTACCGCTCTCGTCACA
TACTACGCCTACCGCAGCTTTTTCCCCGGTGATAGTGCGGGTAGAGAAATCACTTGGCAAGAATTCAGGGCGAAC
TACCTCGAGAAGGGCCTCGTGGATAAATTGACCGTCCTGAACCACACCAAGGTTCGGGTCGATCTCAACCGCGAA
GCTGCCGCTCAAGCAGATTCAAATGGTCAGCCTGCCTCCTATGTCTACTTTAGTATTGGTTCCGTCGACAGCTTC
GAAATGAAGATCGACGCAGCTCAGCGTGAACTCGGTATTCCCTCGCATGAACGTATTCCTGTCGCCTATCACGAT
GAAACCCCATGGGGCGGCGTCTTGATGTCATTGGCTCCTACTATCCTCTTCCTTGGTGGTGTCTTCTGGATGTCT
CGACGTGCTGGCGGCGGCGCCGGCGGCCAAAGTGGAATCTTTGGCATCGGAAAGAGCCGTGCCAAACGCTTCAAC
CACGAGACCGATATCAAGATCAAGTTCTCTGACGTTGCTGGTATGGACGAAGCCAAGGTTGAGATCATGGAATTC
GTTAGCTTCCTCCAGCAACCCGAGCGGTTCGAGAAGTTGGGTGCAAAGATTCCTCGTGGTGCCATTCTCTCAGGT
CCCCCCGGTACTGGTAAGACATTGCTTGCTAAGGCCACTGCTGGTGAATCCGGCGTGCCTTTCTACAGTGTCAGT
GGTTCCGAGTTTGTCGAAATGTTTGTCGGTGTCGGACCCTCTCGTGTCCGCGATCTCTTCGCAACCGCCCGGAAG
AATACCCCCTGCATCATCTTCATTGATGAAATTGATGCGATTGGAAAGTCTCGAGCAAAGTCGAACGTTGGTGGT
GGAAACGATGAACGTGAAAGCACTCTCAACCAGATTCTCACTGAGATGGATGGTTTCAATACCTCTGAGCAAGTG
GTTGTCTTGGCTGGTACCAATCGACCGGATGTTCTTGACAAGGCACTCATGCGTCCCGGACGATTTGACCGACAC
ATCTCCATTGACCGACCTACCATGGATGGTCGTAAACAGATCTTCCGGGTTTACTTGAAGAAGATTGTCACCGAC
GAGAACTTGGAGTACATGGAGGGCAGACTTGCCGCTCTGACTCCTGGTTTCGCTGGTGCTGATATCGCCAACTGC
GTGAACGAGGCAGCTCTTGTTGGTAAGTTCTTATGCATGATTTCTCCGTATCTATCAAAGCTAACACTTTCTCCC
TATAGCTGCCCGTGAAAATGCCGACAAGGTTGTCATGAGACATTTCGAGCAAGCCATCGAACGGGTTGTTGGTGG
ATTGGAAAAGAAGTCTCTTGTGCTCTCCCCTGAGGAGAAGCGGACCGTCGCCTACCACGAGGCTGGCCACGCTAT
CTGTGGTTGGTACTTCAAGTGGGCTGATCCGCTGCTGAAGGTTTCGATCATTCCTCGCGGACAAGGCGCACTAGG
ATATGCCCAATACCTGCCAGCTGGCGGCGACACATATCTGATGAACGTCAACCAGATGATGGACCGCATGGCCAT
GACTCTAGGTGGTCGTGTCAGCGAAGAGTTGCACTTCGATTCCGTGACCAGTGGTGCTAGTGATGATTTCAACAA
GGTCACCCGCATGGCTACTGCCATGGTAACTAAGTTTGGCATGTCGTCCAAGCTTGGTTTCATCTACTACGAGGA
TGACGCACAGCAGCAACTTCACAAGCCCTTCTCGGAGGACACTGCCCGCTCTATTGATCTGGAGGTGCGCCGTAT
CATCGACGAGGCTCACAAGCAGTGCCGCGACCTCCTGACCGAGAAGCGGACGGAGCTTGGTATTGTTGCCGAGGA
GCTTCTTTCTAAAGAGGTTCTTGGACGTGATGACCTCATTCGTCTTCTTGGCCCGCGCCCCTACCCCGAGTCTGG
CGAGTTCGCCAAGTACTTCGATGGCACAGGCGGCCAGACCATTGCCCCATCGGACCACCAGAGCCCCGAAGAAAC
TTCCGGTAACAACGGCCGGGACGAGACACCTATTCCTCCTCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail