Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g311.t1
Gene name
Locationscaffold_01:792209..793127
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 5.1E-53 90 296

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 84 101 17
3 121 143 22
4 158 180 22
5 193 215 22
6 225 247 22
7 268 290 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.18 2.44 13.91
5d_25C Five days - 25 degrees Celsius 3.52 0.63 6.42
7d_25C Seven days - 25 degrees Celsius 4.97 1.08 8.87
10d_25C Ten days - 25 degrees Celsius 5.09 1.22 8.96
7d_15C Seven days - 15 degrees Celsius 1.91 0.06 3.75
7d_30C Seven days - 30 degrees Celsius 8.62 2.67 14.58

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.035243 yes
3d_25C 7d_25C 0.259329 no
3d_25C 7d_15C 0.001804 yes
3d_25C 7d_30C 0.927597 no
3d_25C 10d_25C 0.257364 no
5d_25C 7d_25C 0.516742 no
5d_25C 7d_15C 0.252167 no
5d_25C 7d_30C 0.024170 yes
5d_25C 10d_25C 0.456032 no
7d_25C 7d_15C 0.053684 no
7d_25C 7d_30C 0.199359 no
7d_25C 10d_25C 0.972881 no
7d_15C 7d_30C 0.001804 yes
7d_15C 10d_25C 0.048822 yes
7d_30C 10d_25C 0.202808 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g311.t1
MVHYITGTALERSSPGPSFQITNGKIARSYGYVDPYFPNPGGENDTPVIIYGYTPSIALAAFAAAWFFLHFVYHT
TQSIKNRSWWWMTFSAGLVFEVVGYIARSLSAKKDPYHLIYFILNYFFIVVAPVLLAAGVYTILSALIPRVGSQY
SFLPPRVILAFFITSDVISTIVQIAGACLIGVTESRREDPTTANNILLGGLAYQVFVMTIFVIVAASFQFRARLA
IRANGLGLFCLAFSISTLMIYLRTIFRLAETAQGLMGELQTNEVYFACLEFAPIALVALLFAVWYPGRCVGAAVL
VNDKP*
Coding >Pro_DTO377G3_2|g311.t1
ATGGTTCACTACATCACAGGCACCGCACTTGAACGCAGCTCTCCAGGGCCATCGTTTCAGATCACTAATGGAAAA
ATAGCACGCTCATATGGCTATGTTGACCCCTACTTTCCAAATCCGGGCGGCGAAAATGACACCCCCGTGATCATC
TATGGCTACACTCCTTCCATTGCCCTAGCTGCCTTCGCAGCCGCGTGGTTTTTTCTTCACTTCGTCTACCACACG
ACTCAATCTATCAAGAACCGCAGCTGGTGGTGGATGACCTTTTCCGCCGGTCTGGTTTTCGAGGTTGTAGGGTAC
ATTGCACGATCCCTCTCCGCTAAGAAGGATCCCTATCACCTCATCTACTTCATCCTCAACTACTTTTTTATCGTT
GTGGCACCTGTATTGCTTGCCGCTGGCGTCTACACGATTCTCTCGGCACTGATCCCACGAGTAGGGAGCCAGTAC
TCATTCTTACCTCCAAGGGTCATCCTAGCCTTCTTCATTACTTCGGATGTCATCTCAACAATCGTCCAGATCGCC
GGTGCGTGTCTCATTGGCGTTACAGAGTCGCGCCGGGAAGATCCCACAACGGCGAACAATATCCTCCTGGGCGGC
CTCGCATACCAGGTCTTTGTCATGACTATCTTTGTTATCGTGGCGGCGAGTTTCCAGTTCCGAGCTCGACTTGCT
ATCAGAGCGAATGGGCTTGGGCTCTTCTGCTTGGCTTTTTCAATTTCGACCCTCATGATCTATTTGAGAACTATC
TTCCGTCTTGCGGAAACCGCCCAGGGTCTCATGGGAGAGCTGCAAACCAATGAGGTCTATTTCGCATGCCTTGAA
TTCGCGCCTATTGCGTTAGTGGCTCTTCTCTTTGCCGTCTGGTATCCCGGCCGCTGTGTAGGTGCCGCGGTGCTG
GTTAACGATAAACCATAG
Transcript >Pro_DTO377G3_2|g311.t1
ATGGTTCACTACATCACAGGCACCGCACTTGAACGCAGCTCTCCAGGGCCATCGTTTCAGATCACTAATGGAAAA
ATAGCACGCTCATATGGCTATGTTGACCCCTACTTTCCAAATCCGGGCGGCGAAAATGACACCCCCGTGATCATC
TATGGCTACACTCCTTCCATTGCCCTAGCTGCCTTCGCAGCCGCGTGGTTTTTTCTTCACTTCGTCTACCACACG
ACTCAATCTATCAAGAACCGCAGCTGGTGGTGGATGACCTTTTCCGCCGGTCTGGTTTTCGAGGTTGTAGGGTAC
ATTGCACGATCCCTCTCCGCTAAGAAGGATCCCTATCACCTCATCTACTTCATCCTCAACTACTTTTTTATCGTT
GTGGCACCTGTATTGCTTGCCGCTGGCGTCTACACGATTCTCTCGGCACTGATCCCACGAGTAGGGAGCCAGTAC
TCATTCTTACCTCCAAGGGTCATCCTAGCCTTCTTCATTACTTCGGATGTCATCTCAACAATCGTCCAGATCGCC
GGTGCGTGTCTCATTGGCGTTACAGAGTCGCGCCGGGAAGATCCCACAACGGCGAACAATATCCTCCTGGGCGGC
CTCGCATACCAGGTCTTTGTCATGACTATCTTTGTTATCGTGGCGGCGAGTTTCCAGTTCCGAGCTCGACTTGCT
ATCAGAGCGAATGGGCTTGGGCTCTTCTGCTTGGCTTTTTCAATTTCGACCCTCATGATCTATTTGAGAACTATC
TTCCGTCTTGCGGAAACCGCCCAGGGTCTCATGGGAGAGCTGCAAACCAATGAGGTCTATTTCGCATGCCTTGAA
TTCGCGCCTATTGCGTTAGTGGCTCTTCTCTTTGCCGTCTGGTATCCCGGCCGCTGTGTAGGTGCCGCGGTGCTG
GTTAACGATAAACCATAG
Gene >Pro_DTO377G3_2|g311.t1
ATGGTTCACTACATCACAGGCACCGCACTTGAACGCAGCTCTCCAGGGCCATCGTTTCAGATCACTAATGGAAAA
ATAGCACGCTCATATGGCTATGTTGACCCCTACTTTCCAAATCCGGGCGGCGAAAATGACACCCCCGTGATCATC
TATGGCTACACTCCTTCCATTGCCCTAGCTGCCTTCGCAGCCGCGTGGTTTTTTCTTCACTTCGTCTACCACACG
ACTCAATCTATCAAGAACCGCAGCTGGTGGTGGATGACCTTTTCCGCCGGTCTGGTTTTCGAGGTTGTAGGGTAC
ATTGCACGATCCCTCTCCGCTAAGAAGGATCCCTATCACCTCATCTACTTCATCCTCAACTACTTTTTTATCGTT
GTGGCACCTGTATTGCTTGCCGCTGGCGTCTACACGATTCTCTCGGCACTGATCCCACGAGTAGGGAGCCAGTAC
TCATTCTTACCTCCAAGGGTCATCCTAGCCTTCTTCATTACTTCGGATGTCATCTCAACAATCGTCCAGATCGCC
GGTGCGTGTCTCATTGGCGTTACAGAGTCGCGCCGGGAAGATCCCACAACGGCGAACAATATCCTCCTGGGCGGC
CTCGCATACCAGGTCTTTGTCATGACTATCTTTGTTATCGTGGCGGCGAGTTTCCAGTTCCGAGCTCGACTTGCT
ATCAGAGCGAATGGGCTTGGGCTCTTCTGCTTGGCTTTTTCAATTTCGACCCTCATGATCTATTTGAGAACTATC
TTCCGTCTTGCGGAAACCGCCCAGGGTCTCATGGGAGAGCTGCAAACCAATGAGGTCTATTTCGCATGCCTTGAA
TTCGCGCCTATTGCGTTAGTGGCTCTTCTCTTTGCCGTCTGGTATCCCGGCCGCTGTGTAGGTGCCGCGGTGCTG
GTTAACGATAAACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail