Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g309.t1
Gene name
Locationscaffold_01:786931..788114
Strand-
Gene length (bp)1183
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10494 Stk19 Serine-threonine protein kinase 19 2.1E-90 81 375

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 248.57 150.33 346.81
5d_25C Five days - 25 degrees Celsius 234.66 141.20 328.12
7d_25C Seven days - 25 degrees Celsius 246.39 147.14 345.64
10d_25C Ten days - 25 degrees Celsius 279.89 168.26 391.51
7d_15C Seven days - 15 degrees Celsius 348.20 201.59 494.81
7d_30C Seven days - 30 degrees Celsius 199.63 120.32 278.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.857591 no
3d_25C 7d_25C 0.979966 no
3d_25C 7d_15C 0.151856 no
3d_25C 7d_30C 0.377058 no
3d_25C 10d_25C 0.676198 no
5d_25C 7d_25C 0.879394 no
5d_25C 7d_15C 0.076707 no
5d_25C 7d_30C 0.541765 no
5d_25C 10d_25C 0.491063 no
7d_25C 7d_15C 0.138253 no
7d_25C 7d_30C 0.407330 no
7d_25C 10d_25C 0.651243 no
7d_15C 7d_30C 0.007437 yes
7d_15C 10d_25C 0.390115 no
7d_30C 10d_25C 0.124773 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g309.t1
MTLRLTSAPVSGVKKRKSSAPKPRASPFAALARRKPTYGGGSLKPTADLGFDDPLPDVGGSHFIAETAPVQNVLQ
AIQYIRDGMFEELPARAGMNSTRIAEVLNLRRSLPPLASVAHVHTLLEAPTQVEREIVEQIQAGRIRRLIIPGRG
NDAAGLGDCLVLAEDWDKLVQESPALEQPVKEKFLDILKRIGTSSAISQGVFTTDEYRALLRAGFIVSSSSYTQG
TLSIASLPNLPQMATSSASRSESISHSERPVQSNAQARAATLFLSLPNTGTYLRLLGSGRAHLLALLRRSASSEA
PLGLLKDRWDGAVETDKSFHLAKRARGEFAGVLPGRTKKWKELYGMRFRWALEEALGAGLVEMFETGSVGPGIRC
L*
Coding >Pro_DTO377G3_2|g309.t1
ATGACCTTACGTCTTACCTCCGCTCCGGTATCTGGTGTCAAGAAACGCAAATCCTCTGCTCCCAAACCCCGCGCC
TCGCCCTTTGCCGCCCTTGCGCGCCGAAAACCTACATATGGCGGAGGCAGCCTAAAACCGACTGCAGATCTAGGT
TTCGATGACCCGCTTCCAGATGTAGGCGGGTCTCATTTCATAGCGGAGACTGCACCGGTTCAGAATGTGCTGCAG
GCTATTCAATATATCCGTGATGGCATGTTCGAAGAACTTCCGGCACGGGCAGGAATGAACAGCACGCGTATCGCA
GAAGTCCTCAATCTACGCCGATCTTTGCCTCCCCTCGCCTCTGTGGCACATGTCCATACCCTTCTAGAGGCACCG
ACACAGGTGGAGAGGGAAATCGTCGAACAAATTCAGGCTGGTCGGATTCGGCGACTCATTATACCGGGTCGAGGC
AACGACGCGGCAGGGCTGGGCGATTGTTTGGTGCTAGCAGAGGATTGGGACAAGCTGGTGCAGGAAAGCCCTGCA
TTGGAACAACCAGTGAAGGAGAAATTCCTTGATATACTGAAACGGATTGGAACATCCTCGGCGATATCGCAGGGG
GTCTTCACAACGGATGAGTACAGGGCGCTACTACGTGCCGGCTTTATTGTCTCGTCCTCATCTTACACACAGGGC
ACATTAAGTATTGCATCACTTCCTAATCTACCTCAAATGGCGACTTCGTCAGCCAGTCGAAGCGAGTCTATCTCG
CACTCCGAGCGCCCTGTGCAGTCAAATGCGCAGGCTCGTGCGGCAACTCTGTTCTTGTCTCTTCCTAACACGGGA
ACATATCTCCGCTTGTTAGGGTCAGGTCGTGCACATCTGCTCGCTCTTCTCCGGCGGTCCGCTTCTAGCGAAGCC
CCTCTGGGTCTGTTGAAAGATCGATGGGATGGAGCTGTTGAAACCGACAAGAGCTTTCACTTGGCCAAGCGAGCC
CGTGGCGAGTTTGCAGGGGTCTTGCCGGGTAGGACTAAGAAATGGAAAGAGCTATATGGGATGCGCTTTCGATGG
GCGCTAGAGGAAGCACTAGGCGCGGGACTTGTGGAGATGTTCGAGACTGGCAGCGTTGGACCTGGGATCCGCTGT
CTATAG
Transcript >Pro_DTO377G3_2|g309.t1
ATGACCTTACGTCTTACCTCCGCTCCGGTATCTGGTGTCAAGAAACGCAAATCCTCTGCTCCCAAACCCCGCGCC
TCGCCCTTTGCCGCCCTTGCGCGCCGAAAACCTACATATGGCGGAGGCAGCCTAAAACCGACTGCAGATCTAGGT
TTCGATGACCCGCTTCCAGATGTAGGCGGGTCTCATTTCATAGCGGAGACTGCACCGGTTCAGAATGTGCTGCAG
GCTATTCAATATATCCGTGATGGCATGTTCGAAGAACTTCCGGCACGGGCAGGAATGAACAGCACGCGTATCGCA
GAAGTCCTCAATCTACGCCGATCTTTGCCTCCCCTCGCCTCTGTGGCACATGTCCATACCCTTCTAGAGGCACCG
ACACAGGTGGAGAGGGAAATCGTCGAACAAATTCAGGCTGGTCGGATTCGGCGACTCATTATACCGGGTCGAGGC
AACGACGCGGCAGGGCTGGGCGATTGTTTGGTGCTAGCAGAGGATTGGGACAAGCTGGTGCAGGAAAGCCCTGCA
TTGGAACAACCAGTGAAGGAGAAATTCCTTGATATACTGAAACGGATTGGAACATCCTCGGCGATATCGCAGGGG
GTCTTCACAACGGATGAGTACAGGGCGCTACTACGTGCCGGCTTTATTGTCTCGTCCTCATCTTACACACAGGGC
ACATTAAGTATTGCATCACTTCCTAATCTACCTCAAATGGCGACTTCGTCAGCCAGTCGAAGCGAGTCTATCTCG
CACTCCGAGCGCCCTGTGCAGTCAAATGCGCAGGCTCGTGCGGCAACTCTGTTCTTGTCTCTTCCTAACACGGGA
ACATATCTCCGCTTGTTAGGGTCAGGTCGTGCACATCTGCTCGCTCTTCTCCGGCGGTCCGCTTCTAGCGAAGCC
CCTCTGGGTCTGTTGAAAGATCGATGGGATGGAGCTGTTGAAACCGACAAGAGCTTTCACTTGGCCAAGCGAGCC
CGTGGCGAGTTTGCAGGGGTCTTGCCGGGTAGGACTAAGAAATGGAAAGAGCTATATGGGATGCGCTTTCGATGG
GCGCTAGAGGAAGCACTAGGCGCGGGACTTGTGGAGATGTTCGAGACTGGCAGCGTTGGACCTGGGATCCGCTGT
CTATAG
Gene >Pro_DTO377G3_2|g309.t1
ATGACCTTACGTCTTACCTCCGCTCCGGTATCTGGTGTCAAGAAACGCAAATCCTCTGCTCCCAAACCCCGCGCC
TCGCCCTTTGCCGCCCTTGCGCGCCGAAAACCTACATATGGCGGAGGCAGCCTAAAACCGACTGCAGATCTAGGT
TTCGATGACCCGCTTCCAGATGTAGGCGGGTCTCATTTCATAGCGGAGACTGCACCGGTTCAGAATGTGCTGCAG
GCTATTCAATATATCCGTGATGGCATGTTCGAAGAACTTCCGGCACGGGCAGGAATGAACAGCACGCGTATCGCA
GAAGTCCTCAATCTACGCCGATCTTTGCCTCCCCTCGCCTCTGTGGCACATGTCCATACCCTTCTAGAGGCACCG
ACACAGGTGGAGAGGGAAATCGTCGAACAAATTCAGGCTGGTCGGATTCGGCGACTCATTATACCGGGTCGAGGC
AACGACGCGGCAGGGCTGGGCGATTGTTTGGTGCTAGCAGAGGATTGGGACAAGCTGGTGCAGGAAAGCCCTGCA
TTGGAACAACCAGTGAAGGGTGAGTTTTGGAGTTGGGATTCTTTGGACGTCGCCAACTGACAAGTTTGCAGAGAA
ATTCCTTGATATACTGAAACGGATTGGAACATCCTCGGCGATATCGCAGGGGGTCTTCACAACGGATGAGTACAG
GGCGCTACTACGTGCCGGCTTTATTGTCTCGTCCTCATCTTACACACAGGGCACATTAAGTATTGCATCACTTCC
TAATCTACCTCAAATGGCGACTTCGTCAGCCAGTCGAAGCGAGTCTATCTCGCACTCCGAGCGCCCTGTGCAGTC
AAATGCGCAGGCTCGTGCGGCAACTCTGTTCTTGTCTCTTCCTAACACGGGAACATATCTCCGCTTGTTAGGGTC
AGGTCGTGCACATCTGCTCGCTCTTCTCCGGCGGTCCGCTTCTAGCGAAGCCCCTCTGGGTCTGTTGAAAGATCG
ATGGGATGGAGCTGTTGAAACCGACAAGAGCTTTCACTTGGCCAAGCGAGCCCGTGGCGAGTTTGCAGGGGTCTT
GCCGGGTAGGACTAAGAAATGGAAAGAGCTATATGGGATGCGCTTTCGATGGGCGCTAGAGGAAGCACTAGGCGC
GGGACTTGTGGAGATGTTCGAGACTGGCAGCGTTGGACCTGGGATCCGCTGTCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail