Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3081.t1
Gene name
Locationscaffold_04:656236..657211
Strand-
Gene length (bp)975
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03311 Cornichon Cornichon protein 1.4E-49 49 169

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 24 43 19
2 50 72 22
3 101 123 22
4 154 176 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 310.75 190.69 430.80
5d_25C Five days - 25 degrees Celsius 315.77 193.94 437.61
7d_25C Seven days - 25 degrees Celsius 348.91 214.03 483.79
10d_25C Ten days - 25 degrees Celsius 422.49 259.00 585.98
7d_15C Seven days - 15 degrees Celsius 295.83 181.85 409.81
7d_30C Seven days - 30 degrees Celsius 316.53 194.36 438.70

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.963681 no
3d_25C 7d_25C 0.674642 no
3d_25C 7d_15C 0.878221 no
3d_25C 7d_30C 0.959510 no
3d_25C 10d_25C 0.178570 no
5d_25C 7d_25C 0.718447 no
5d_25C 7d_15C 0.831730 no
5d_25C 7d_30C 0.994202 no
5d_25C 10d_25C 0.195729 no
7d_25C 7d_15C 0.517217 no
7d_25C 7d_30C 0.739723 no
7d_25C 10d_25C 0.437830 no
7d_15C 7d_30C 0.829757 no
7d_15C 10d_25C 0.104487 no
7d_30C 10d_25C 0.213066 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3081.t1
MTSPPDTADRSSLIETLSFDPTSSLLSTLFFISISLSAFSFVFPFKFSWLYLLSVLINAVNLFLQVFFTIMYSDL
ECDYINPIDLCNRLNAYIIPEAAVHAFLTFLFVINGYWLAIVLNLPLVLFNAKKIYENQHLLDATEIFRKLNVHK
KESFIKLGFHLLMFFFYLYSMIVALIRDEGN*
Coding >Pro_DTO377G3_2|g3081.t1
ATGACCAGCCCTCCCGACACCGCCGACCGCAGTTCGCTAATCGAAACTCTTTCTTTCGATCCCACCTCATCTCTG
CTCAGTACGTTGTTTTTCATCTCCATCAGCTTGAGTGCATTTAGCTTTGTTTTTCCATTCAAATTCTCATGGCTT
TACCTGTTGTCGGTGTTGATCAACGCCGTCAACCTCTTCCTCCAGGTGTTCTTCACGATCATGTACAGTGATCTT
GAATGCGATTACATCAACCCTATCGACCTTTGCAACCGCCTCAACGCCTACATCATCCCCGAAGCCGCTGTCCAC
GCGTTCCTGACCTTCCTCTTCGTGATCAACGGATACTGGCTCGCCATCGTGCTGAACCTACCCCTCGTGTTGTTC
AACGCCAAGAAGATCTACGAGAACCAGCACCTTTTGGATGCGACCGAGATTTTCCGCAAGTTGAACGTGCACAAG
AAGGAATCCTTCATCAAGCTTGGCTTCCACCTTCTTATGTTCTTCTTCTATCTTTACAGCATGATTGTTGCCCTG
ATCCGTGATGAGGGTAATTGA
Transcript >Pro_DTO377G3_2|g3081.t1
ATGACCAGCCCTCCCGACACCGCCGACCGCAGTTCGCTAATCGAAACTCTTTCTTTCGATCCCACCTCATCTCTG
CTCAGTACGTTGTTTTTCATCTCCATCAGCTTGAGTGCATTTAGCTTTGTTTTTCCATTCAAATTCTCATGGCTT
TACCTGTTGTCGGTGTTGATCAACGCCGTCAACCTCTTCCTCCAGGTGTTCTTCACGATCATGTACAGTGATCTT
GAATGCGATTACATCAACCCTATCGACCTTTGCAACCGCCTCAACGCCTACATCATCCCCGAAGCCGCTGTCCAC
GCGTTCCTGACCTTCCTCTTCGTGATCAACGGATACTGGCTCGCCATCGTGCTGAACCTACCCCTCGTGTTGTTC
AACGCCAAGAAGATCTACGAGAACCAGCACCTTTTGGATGCGACCGAGATTTTCCGCAAGTTGAACGTGCACAAG
AAGGAATCCTTCATCAAGCTTGGCTTCCACCTTCTTATGTTCTTCTTCTATCTTTACAGCATGATTGTTGCCCTG
ATCCGTGATGAGGGTAATTGA
Gene >Pro_DTO377G3_2|g3081.t1
ATGACCAGCCCTCCCGACACCGCCGACCGCAGTTCGCTAATCGAAACTCTTTCTTTCGATCCCACCTCATCTCTG
CTCAGTACGTTGTTTTTCATCTCCATCAGCTTGAGTGCATTTAGCTTTGTTTTTGTGAGTGAGCTTTGATCCCTC
TTTGGAGAGGACTCTGTGCGATTCGTCTGTCTTCCTTGGGCGGAAGAACCCCACAAACATCTCCAATTCCGGCCT
CTTCAATCCACCTCAACCTCACCCACTTTTGTCGCCGACAGTTTACTCATATCCTCTGTTTAGCCATTCAAATTC
TGTCAATTATACTTGACGCAACGTCAAAATCGCAATGATGTCTGGCGAAGCATGGCTTTACCTGTTGTCGGTGTT
GATCAACGCCGTCAACCTCTTCCTCCAGGTGTTCTTCACGATCATGTACAGTGATCTTGAATGGTGAGTCTTCGC
AGTCGTCCCAAGCAACAGTTTTTGATCCACACATACTGCCGAATACAAGCTGACACTTCACCTTTTTTTCCCAGC
GATTACATCAACCCTATCGACCTTTGCAACCGCCTCAACGCCTACATCATCCCCGAAGCCGCTGTCCACGCGTTC
CTGACCTTCCTCTTCGTGATCAACGGATACTGGCTCGCCATCGTGCTGAACCTACCCCTCGTGTTGTTCAACGCC
AAGAAGTACGTTGGAAGCTCCCCGAGTAGTCGCAAGCCCTCTTCAGCGGTAGGCTAACCGTGTCGTTTTTGAAAA
TACAGGATCTACGAGAACCAGCACCTTTTGGATGCGACCGAGATTTTCCGCAAGTTGAACGTGCACAAGAAGGTA
TGTTTGGTTTCTACCTCCCAATTTACCGCACAGTGACTGACTCGAAATCGTGTTTAGGAATCCTTCATCAAGCTT
GGCTTCCACCTTCTTATGTTCTTCTTCTATCTTTACAGCATGATTGTTGCCCTGATCCGTGATGAGGGTAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail