Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3077.t1
Gene name
Locationscaffold_04:647609..649502
Strand-
Gene length (bp)1893
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-43 64 463
PF00083 Sugar_tr Sugar (and other) transporter 9.8E-14 93 231

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 93 112 19
3 125 142 17
4 152 174 22
5 181 203 22
6 208 230 22
7 251 268 17
8 278 300 22
9 321 343 22
10 353 375 22
11 382 404 22
12 419 441 22
13 453 475 22
14 526 543 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 10.44 4.58 16.30
5d_25C Five days - 25 degrees Celsius 7.88 3.10 12.66
7d_25C Seven days - 25 degrees Celsius 9.98 4.36 15.60
10d_25C Ten days - 25 degrees Celsius 8.31 3.43 13.20
7d_15C Seven days - 15 degrees Celsius 18.88 9.72 28.03
7d_30C Seven days - 30 degrees Celsius 9.82 4.11 15.53

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.455910 no
3d_25C 7d_25C 0.926222 no
3d_25C 7d_15C 0.032838 yes
3d_25C 7d_30C 0.899884 no
3d_25C 10d_25C 0.554074 no
5d_25C 7d_25C 0.531580 no
5d_25C 7d_15C 0.002761 yes
5d_25C 7d_30C 0.584147 no
5d_25C 10d_25C 0.917705 no
7d_25C 7d_15C 0.019624 yes
7d_25C 7d_30C 0.974390 no
7d_25C 10d_25C 0.651416 no
7d_15C 7d_30C 0.021921 yes
7d_15C 10d_25C 0.002297 yes
7d_30C 10d_25C 0.699528 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3077.t1
MAPETSPTENSPLLGSVSVNGAVSNGTIPDHHVESGDTVQAEERRKESSNDAQKQLKYIVPAISLGIFLSAADQT
IIMASYGQIGSDLKALNLTSWIATSYFLTLTSFQPLYGKLSDIFGRKPCLLFAYAVFGLGCLGCGLARDINELIA
ARVFQGIGGGGMTTVVSILMSDIVPLRDRGLWQGIINIIYATGAGTGAPLGGILSDYIGWRWAFLAQFPLCIIAF
IAVSFLLKLPPRDSAHWKTKLRRIDFLGAVVLVGAVLGFLVGLDRGSNVSWRLPLTIASLAVSAVLFVVFILVEI
YLAAEPFAPGHIIFNRTFFACYSCNFFSFGGWIAALFYIPLYFQAVDDVSATTAGLRLLPSILAGVTGSVFAGLL
MKWSGKYYWLTIAAYASLTTGVFCIYLFSGGVVASTVPMICGMVISAFGNGIGVTTTLIGLISNATYEDQAVVTA
CSYLFRSLGSVIGLSLSSTVVQQVLRNRLQSGLRDSKNIDQIVEGVRESLDFIKTLDPATARIVRDSYGWSTNKG
FAFLVFVVFFALLSSCFIRESKLNR*
Coding >Pro_DTO377G3_2|g3077.t1
ATGGCTCCAGAGACATCTCCTACCGAGAACTCCCCGTTGCTGGGATCCGTATCTGTTAACGGCGCTGTGTCCAAC
GGCACGATTCCCGATCATCATGTGGAATCAGGGGATACAGTTCAAGCAGAGGAGCGAAGAAAAGAGTCGTCCAAT
GACGCACAGAAGCAGCTCAAATATATTGTGCCTGCCATCTCGCTCGGAATTTTCTTGTCGGCGGCAGACCAGACA
ATTATCATGGCCAGTTATGGTCAGATTGGTAGCGACTTGAAAGCTCTCAACCTGACCAGTTGGATTGCTACTTCT
TACTTTCTCACTTTAACATCATTCCAACCTCTATATGGCAAGCTAAGCGACATATTTGGTCGCAAGCCGTGCCTC
CTCTTTGCATATGCGGTTTTCGGCCTTGGATGCTTGGGCTGCGGTTTAGCTCGGGATATTAATGAGTTGATCGCT
GCTCGTGTCTTCCAAGGCATTGGTGGTGGTGGTATGACCACCGTCGTAAGCATTTTGATGAGTGATATTGTTCCT
CTTCGCGATCGAGGCCTATGGCAGGGTATTATCAATATCATCTATGCCACAGGTGCCGGTACCGGTGCACCCTTG
GGTGGAATTCTCTCCGACTACATTGGCTGGCGCTGGGCGTTTCTAGCGCAATTCCCCCTCTGCATTATTGCTTTC
ATTGCCGTGTCTTTCCTGCTCAAGCTGCCTCCTCGCGATAGCGCCCATTGGAAGACCAAGCTGCGTCGCATCGAC
TTCCTTGGCGCCGTAGTCCTTGTTGGCGCTGTTCTTGGTTTCCTAGTTGGTCTTGATCGTGGCAGTAATGTGTCA
TGGAGATTACCCCTGACAATTGCCTCGCTAGCTGTCTCTGCTGTCTTGTTCGTGGTCTTTATCTTAGTTGAGATC
TACCTAGCAGCCGAACCCTTTGCGCCTGGTCACATCATCTTCAACCGAACATTCTTTGCTTGCTACAGCTGCAAC
TTCTTCAGCTTCGGGGGATGGATTGCCGCCCTGTTCTATATTCCATTATACTTCCAAGCAGTAGATGATGTCTCT
GCCACGACTGCGGGACTGCGCTTACTGCCAAGCATTCTAGCTGGTGTCACTGGGTCCGTGTTTGCGGGCTTGTTG
ATGAAATGGTCTGGCAAGTATTACTGGCTGACAATTGCTGCGTATGCTTCCCTGACAACTGGTGTGTTCTGTATA
TACCTGTTCTCCGGTGGTGTGGTGGCTAGTACAGTCCCGATGATCTGCGGGATGGTGATTTCGGCATTCGGCAAT
GGCATTGGTGTCACTACAACTTTGATCGGTTTGATATCGAATGCTACATATGAAGATCAGGCGGTCGTCACTGCT
TGCTCATATCTATTCCGCTCATTGGGATCCGTGATTGGTCTCTCTTTATCATCAACTGTCGTTCAGCAAGTCTTA
CGGAATCGATTGCAATCAGGTCTACGTGACAGTAAGAACATTGATCAAATTGTCGAAGGAGTGCGAGAAAGTCTG
GACTTTATCAAAACGCTCGACCCAGCAACTGCCAGGATTGTCCGGGACTCGTATGGCTGGTCCACCAACAAGGGA
TTCGCCTTTTTGGTTTTTGTCGTGTTCTTCGCTTTGTTAAGCAGCTGTTTCATCCGTGAAAGCAAACTCAACCGC
TAA
Transcript >Pro_DTO377G3_2|g3077.t1
ATGGCTCCAGAGACATCTCCTACCGAGAACTCCCCGTTGCTGGGATCCGTATCTGTTAACGGCGCTGTGTCCAAC
GGCACGATTCCCGATCATCATGTGGAATCAGGGGATACAGTTCAAGCAGAGGAGCGAAGAAAAGAGTCGTCCAAT
GACGCACAGAAGCAGCTCAAATATATTGTGCCTGCCATCTCGCTCGGAATTTTCTTGTCGGCGGCAGACCAGACA
ATTATCATGGCCAGTTATGGTCAGATTGGTAGCGACTTGAAAGCTCTCAACCTGACCAGTTGGATTGCTACTTCT
TACTTTCTCACTTTAACATCATTCCAACCTCTATATGGCAAGCTAAGCGACATATTTGGTCGCAAGCCGTGCCTC
CTCTTTGCATATGCGGTTTTCGGCCTTGGATGCTTGGGCTGCGGTTTAGCTCGGGATATTAATGAGTTGATCGCT
GCTCGTGTCTTCCAAGGCATTGGTGGTGGTGGTATGACCACCGTCGTAAGCATTTTGATGAGTGATATTGTTCCT
CTTCGCGATCGAGGCCTATGGCAGGGTATTATCAATATCATCTATGCCACAGGTGCCGGTACCGGTGCACCCTTG
GGTGGAATTCTCTCCGACTACATTGGCTGGCGCTGGGCGTTTCTAGCGCAATTCCCCCTCTGCATTATTGCTTTC
ATTGCCGTGTCTTTCCTGCTCAAGCTGCCTCCTCGCGATAGCGCCCATTGGAAGACCAAGCTGCGTCGCATCGAC
TTCCTTGGCGCCGTAGTCCTTGTTGGCGCTGTTCTTGGTTTCCTAGTTGGTCTTGATCGTGGCAGTAATGTGTCA
TGGAGATTACCCCTGACAATTGCCTCGCTAGCTGTCTCTGCTGTCTTGTTCGTGGTCTTTATCTTAGTTGAGATC
TACCTAGCAGCCGAACCCTTTGCGCCTGGTCACATCATCTTCAACCGAACATTCTTTGCTTGCTACAGCTGCAAC
TTCTTCAGCTTCGGGGGATGGATTGCCGCCCTGTTCTATATTCCATTATACTTCCAAGCAGTAGATGATGTCTCT
GCCACGACTGCGGGACTGCGCTTACTGCCAAGCATTCTAGCTGGTGTCACTGGGTCCGTGTTTGCGGGCTTGTTG
ATGAAATGGTCTGGCAAGTATTACTGGCTGACAATTGCTGCGTATGCTTCCCTGACAACTGGTGTGTTCTGTATA
TACCTGTTCTCCGGTGGTGTGGTGGCTAGTACAGTCCCGATGATCTGCGGGATGGTGATTTCGGCATTCGGCAAT
GGCATTGGTGTCACTACAACTTTGATCGGTTTGATATCGAATGCTACATATGAAGATCAGGCGGTCGTCACTGCT
TGCTCATATCTATTCCGCTCATTGGGATCCGTGATTGGTCTCTCTTTATCATCAACTGTCGTTCAGCAAGTCTTA
CGGAATCGATTGCAATCAGGTCTACGTGACAGTAAGAACATTGATCAAATTGTCGAAGGAGTGCGAGAAAGTCTG
GACTTTATCAAAACGCTCGACCCAGCAACTGCCAGGATTGTCCGGGACTCGTATGGCTGGTCCACCAACAAGGGA
TTCGCCTTTTTGGTTTTTGTCGTGTTCTTCGCTTTGTTAAGCAGCTGTTTCATCCGTGAAAGCAAACTCAACCGC
TAA
Gene >Pro_DTO377G3_2|g3077.t1
ATGGCTCCAGAGACATCTCCTACCGAGAACTCCCCGTTGCTGGGATCCGTATCTGTTAACGGCGCTGTGTCCAAC
GGCACGATTCCCGATCATCATGTGGAATCAGGGGATACAGTTCAAGCAGAGGAGCGAAGAAAAGAGTCGTCCAAT
GACGCACAGAAGCAGCTCAAATATATTGTGCCTGCCATCTCGCTCGGAGTATGGATTCTTCCAATGTTTATTGAT
TCTGTTTTCTGAAATCGAAGTTGTGACTAACGGGATATATAGATTTTCTTGTCGGCGGCAGACCAGACAATTATC
ATGGCCAGTTATGGTCAGATTGGTAGCGACTTGAAAGCTCTCAACCTGACCAGTTGGATTGCTACTTCTTACTTT
CTCACTTTAACATCATTCCAACCTCTATATGGCAAGCTAAGCGACATATTTGGTCGCAAGCCGTGCCTCCTCTTT
GCATATGCGGTTTTCGGCCTTGGATGCTTGGGCTGCGGTTTAGCTCGGGATATTAATGAGTTGATCGCTGCTCGT
GTATGTTCACATATGATCTCAGGTCTGAATCATGTAATGCTGACTATTTCGAACAGGTCTTCCAAGGCATTGGTG
GTGGTGGTATGACCACCGTCGTAAGCATTTTGATGAGTGATATTGTTCCTCTTCGCGATCGAGGCCTATGGCAGG
GTATTATCAATATCATCTATGCCACAGGTGCCGGTACCGGTGCACCCTTGGGTGGAATTCTCTCCGACTACATTG
GCTGGCGCTGGTATGAATGATGCGAGACCCACATTTCCTTGCGCCATCTGACGTTTTTTTACTTAGGGCGTTTCT
AGCGCAATTCCCCCTCTGCATTATTGCTTTCATTGCCGTGTCTTTCCTGCTCAAGCTGCCTCCTCGCGATAGCGC
CCATTGGAAGACCAAGCTGCGTCGCATCGACTTCCTTGGCGCCGTAGTCCTTGTTGGCGCTGTTCTTGGTTTCCT
AGTTGGTCTTGATCGTGGCAGTAATGTGTCATGGAGATTACCCCTGACAATTGCCTCGCTAGCTGTCTCTGCTGT
CTTGTTCGTGGTCTTTATCTTAGTTGAGATCTACCTAGCAGCCGAACCCTTTGCGCCTGGTCACATCATCTTCAA
CCGAACATTCTTTGCTTGCTACAGCTGCAACTTCTTCAGCTTCGGGGGATGGATTGCCGCCCTGTTCTATATTCC
ATTATACTTCCAAGCAGTAGATGATGTCTCTGCCACGACTGCGGGACTGCGCTTACTGCCAAGCATTCTAGCTGG
TGTCACTGGGTCCGTGTTTGCGGGCTTGTTGATGAAATGGTCTGGCAAGTATTACTGGCTGACAATTGCTGCGTA
TGCTTCCCTGACAACTGGTGTGTTCTGTATATACCTGTTCTCCGGTGGTGTGGTGGCTAGTACAGTCCCGATGAT
CTGCGGGATGGTGATTTCGGCATTCGGCAATGGCATTGGTGTCACTACAACTTTGATCGGTTTGAGTGAGTTTTT
ATCTGATCTTGCTCTGCAATCCTTCAATATATGCTAACCAATCCGCCAGTATCGAATGCTACATATGAAGATCAG
GCGGTCGTCACTGCTTGCTCATATCTATTCCGCTCATTGGGATCCGTGATTGGTCTCTCTTTATCATCAACTGTC
GTTCAGCAAGTCTTACGGAATCGATTGCAATCAGGTCTACGTGACAGTAAGAACATTGATCAAATTGTCGAAGGA
GTGCGAGAAAGTCTGGACTTTATCAAAACGCTCGACCCAGCAACTGCCAGGATTGTCCGGGACTCGTATGGCTGG
TCCACCAACAAGGGATTCGCCTTTTTGGTTTTTGTCGTGTTCTTCGCTTTGTTAAGCAGCTGTTTCATCCGTGAA
AGCAAACTCAACCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail