Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3076.t1
Gene name
Locationscaffold_04:643665..647031
Strand-
Gene length (bp)3366
Transcript length (bp)3366
Coding sequence length (bp)3366
Protein length (aa) 1122

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 8.2E-12 268 304
PF13499 EF-hand_7 EF-hand domain pair 4.8E-07 414 474

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3076.t1
MSDSRPGPVSLARYRPILYLFTGVAAAYAILYVHNNVISQPSSSSLRRRNAVRRTRPTEAEEPGIADTPSYRAIT
HLEQLEHQNGVYGTFRIETEDGRRVESGLLPSLLATRDQLMEEVGVPPAHAERMREMMEDTFLESFLALDFPSAH
ILPEDTAERTYLTEQLQRRGISRAGIERALVRFNGDTNYGEELRRRRQNGERVTLSTSTFPDVSAPPQNIDGGET
VVDDQSVFSWRDGNNDPSNREGQNLLNLLYHIAEDQARRDGYIHRGVTCNSCGAMPIQGIRYRCANCIDYDLCET
CEAMQVHIKTHLFYKVRIPAPFLGNPRQSQPVWYPGKPSMLPRSLPRPLAKRLMKDCNFENTELDALWDQFRCLA
NYEWANDPNKLHMAIDRKTFDRCFVPNTSIRPPPPSLIYDRMFAFYDTNGDNLIGFEEFLKGLASLNNKSNDERL
RRVFRGYDIDGDGFVERKDFLRVFRAYYALSRELTRDMVAGMEDDFLEGGARDVVLGSQPISSAFPGSIPSGERS
RTGEGKSMNSEGDMEIIDNEGILRQDGDDTGDRHLVVGDAAVRAQFSRMRPLFPSTLRLAPAETTPRPPDAIESD
QNEDDEEEDEDGASESGSDQSSSSVASGTWPPVEHILEEDIISALGTYIPAREITDPIDRARVADAVYHRMREDD
QRRVFDARQRGIDERWRRRAFYTDEEDGATIPAGYERDPAIDDFSDDEDLNESVSRPPSFRSRSSSKVRFQDDLN
DDEYDIRSNPSTSSRSIPVGERWGGFEIPEVERDVGKEILYQVTQQGFNELLDILFKPKEDLMMEVYRTRADRKL
WAREIELAAKEDPSKRTTTENPPVEEELEEIINSQPLDDLLQRAGYQIRSPVLVPENTGPVLAPSPGPTVSDEGD
EDEYEDDDDVRPTHLADPGRDTGFGQARPFVESATTSATSSDYGDDIAASASGVGPSSPVVEEERLHCDPTLPQH
RPDEPFVMTQEVIAESDSDLEESPIRNTNPDLPDRFRLQPGTISLPAPSSPRSSPEAEATAPKLPPSPMQPLPPP
HRVNDLPRDTAPRRPSPRTLARWVYLDQVERENKERGHGARLNFEEFSRRMAADRGRRLAFVASWIEMASF*
Coding >Pro_DTO377G3_2|g3076.t1
ATGTCCGACTCGCGCCCAGGGCCAGTCTCACTAGCACGATATCGACCTATCCTCTACCTCTTCACTGGTGTCGCT
GCTGCCTATGCGATTCTCTATGTTCACAACAATGTCATCTCGCAGCCATCATCAAGTTCACTCCGACGTCGAAAT
GCTGTGCGCCGGACGAGACCAACCGAAGCCGAAGAACCTGGGATCGCTGATACTCCGTCTTATCGAGCTATTACC
CACCTTGAACAGCTAGAGCATCAGAATGGTGTATATGGGACATTTCGCATCGAGACGGAGGATGGGCGTCGCGTG
GAGAGCGGTCTTCTTCCATCACTCCTCGCAACACGCGACCAGCTAATGGAAGAAGTGGGCGTCCCGCCTGCTCAT
GCAGAGCGCATGCGCGAGATGATGGAGGATACATTTCTTGAATCCTTCCTTGCACTCGATTTCCCGTCTGCACAT
ATTCTCCCAGAGGATACCGCAGAAAGAACATACCTGACAGAACAACTTCAACGCCGAGGTATCTCCCGAGCTGGT
ATTGAAAGGGCTCTGGTCCGGTTCAACGGAGATACGAACTACGGCGAAGAGCTGCGTCGGCGACGACAGAACGGT
GAACGTGTCACTCTCTCAACCTCCACTTTTCCAGACGTGTCTGCCCCTCCACAGAATATTGACGGCGGTGAGACG
GTGGTGGACGACCAGAGCGTCTTCTCATGGCGTGATGGAAACAACGATCCTTCTAATAGGGAAGGTCAAAACCTG
CTTAACCTGCTTTATCATATTGCCGAGGATCAGGCGCGGAGGGACGGCTATATCCATCGTGGGGTTACTTGCAAC
AGCTGTGGTGCCATGCCGATTCAGGGTATCAGATACCGATGTGCCAATTGCATCGACTACGATCTCTGTGAGACG
TGCGAGGCAATGCAGGTCCATATCAAAACACATTTGTTCTACAAAGTGCGGATTCCAGCCCCATTCTTAGGAAAC
CCTCGTCAATCCCAGCCTGTATGGTATCCCGGGAAGCCTTCAATGCTCCCGCGCAGTCTTCCACGCCCTCTTGCC
AAGCGTCTTATGAAAGACTGCAATTTCGAAAATACGGAGCTTGATGCACTCTGGGATCAGTTCCGCTGTTTGGCC
AATTATGAGTGGGCAAATGACCCAAACAAGTTGCATATGGCCATCGATCGCAAAACATTCGACCGATGCTTTGTG
CCTAATACTTCTATCCGGCCGCCGCCCCCGAGTCTCATTTACGACCGAATGTTCGCATTCTATGACACCAATGGC
GACAATCTTATCGGGTTCGAGGAATTCCTGAAGGGCTTGGCCAGTCTCAACAACAAAAGCAACGACGAACGGCTG
CGACGGGTGTTCCGCGGCTACGACATCGATGGAGATGGCTTTGTCGAACGCAAGGACTTCCTTCGGGTTTTCAGG
GCATACTATGCGCTGAGCCGAGAGCTTACAAGGGACATGGTTGCTGGCATGGAGGATGACTTCCTAGAGGGTGGA
GCCCGTGATGTGGTACTTGGTAGCCAGCCTATCAGCTCTGCATTCCCTGGTAGCATCCCTTCAGGTGAACGTTCT
CGCACAGGAGAAGGCAAGAGCATGAATTCCGAGGGGGACATGGAAATCATTGACAACGAAGGAATCTTGCGACAG
GACGGAGATGATACTGGTGATCGGCATTTGGTCGTGGGTGATGCTGCTGTCAGAGCACAATTTAGTCGAATGAGG
CCATTGTTCCCATCTACACTACGCCTAGCACCCGCCGAGACTACTCCTCGCCCGCCAGATGCCATAGAGAGTGAC
CAAAATGAAGACGACGAAGAAGAAGATGAGGATGGTGCTAGCGAGAGTGGATCAGACCAATCTAGCTCGTCGGTG
GCCAGTGGTACCTGGCCCCCAGTTGAACACATCCTCGAAGAAGATATTATTTCTGCTCTCGGGACCTATATTCCC
GCTCGGGAAATCACGGATCCAATTGATCGGGCTCGCGTCGCGGATGCTGTTTATCACAGAATGCGCGAAGATGAT
CAGAGACGTGTGTTTGACGCTCGTCAGCGTGGAATTGACGAACGTTGGAGGCGCCGCGCCTTCTATACAGACGAA
GAAGATGGCGCCACTATCCCTGCAGGGTATGAAAGGGATCCGGCCATTGATGACTTCAGCGATGATGAAGACCTT
AATGAATCGGTATCGCGCCCACCCTCTTTCCGTTCGCGGTCCTCGTCCAAGGTGCGATTCCAGGATGATCTCAAC
GACGATGAGTACGACATTCGATCTAACCCATCCACCTCGTCCCGGAGTATTCCTGTTGGCGAGCGATGGGGTGGC
TTTGAAATCCCAGAGGTCGAAAGGGACGTTGGGAAAGAAATCCTATATCAAGTCACGCAACAGGGATTCAACGAG
CTTCTAGATATTCTATTCAAGCCGAAAGAGGACCTTATGATGGAGGTCTATCGCACGAGAGCTGATCGCAAGTTG
TGGGCCCGCGAGATTGAACTCGCAGCAAAAGAGGACCCCTCGAAACGCACCACAACTGAGAATCCCCCAGTGGAG
GAGGAACTCGAGGAAATTATCAACAGTCAGCCACTTGATGATCTATTACAGCGCGCTGGTTACCAGATTCGGAGC
CCAGTCCTGGTACCTGAGAATACCGGACCAGTGCTAGCTCCGTCGCCGGGGCCCACCGTTTCAGATGAGGGTGAT
GAGGATGAGTATGAAGACGATGACGACGTGCGACCAACTCATCTCGCCGATCCCGGAAGAGATACTGGATTTGGG
CAAGCACGGCCATTTGTGGAATCCGCCACAACGTCCGCCACTTCGTCTGATTATGGCGATGATATCGCTGCCTCT
GCGTCTGGTGTGGGGCCATCCAGCCCGGTTGTTGAAGAGGAAAGACTCCACTGCGATCCAACTCTCCCACAGCAT
CGTCCCGACGAGCCATTCGTGATGACCCAGGAAGTGATTGCTGAATCAGACTCCGACTTGGAGGAATCACCAATT
AGGAACACAAACCCTGATCTCCCTGATCGGTTCCGACTCCAGCCCGGGACCATCTCTCTTCCCGCCCCATCTTCT
CCCCGCTCCTCCCCAGAAGCCGAAGCCACAGCCCCCAAGCTTCCTCCTTCTCCTATGCAACCACTCCCACCTCCT
CATCGGGTCAATGACCTGCCTCGTGACACTGCCCCACGCCGACCTTCGCCCCGGACCCTAGCTCGGTGGGTCTAT
TTAGACCAGGTGGAACGTGAAAACAAGGAACGTGGTCACGGTGCGAGACTTAACTTTGAAGAGTTCTCGCGCCGT
ATGGCTGCTGATCGAGGGCGCCGACTCGCATTTGTGGCCAGTTGGATTGAGATGGCTAGCTTTTGA
Transcript >Pro_DTO377G3_2|g3076.t1
ATGTCCGACTCGCGCCCAGGGCCAGTCTCACTAGCACGATATCGACCTATCCTCTACCTCTTCACTGGTGTCGCT
GCTGCCTATGCGATTCTCTATGTTCACAACAATGTCATCTCGCAGCCATCATCAAGTTCACTCCGACGTCGAAAT
GCTGTGCGCCGGACGAGACCAACCGAAGCCGAAGAACCTGGGATCGCTGATACTCCGTCTTATCGAGCTATTACC
CACCTTGAACAGCTAGAGCATCAGAATGGTGTATATGGGACATTTCGCATCGAGACGGAGGATGGGCGTCGCGTG
GAGAGCGGTCTTCTTCCATCACTCCTCGCAACACGCGACCAGCTAATGGAAGAAGTGGGCGTCCCGCCTGCTCAT
GCAGAGCGCATGCGCGAGATGATGGAGGATACATTTCTTGAATCCTTCCTTGCACTCGATTTCCCGTCTGCACAT
ATTCTCCCAGAGGATACCGCAGAAAGAACATACCTGACAGAACAACTTCAACGCCGAGGTATCTCCCGAGCTGGT
ATTGAAAGGGCTCTGGTCCGGTTCAACGGAGATACGAACTACGGCGAAGAGCTGCGTCGGCGACGACAGAACGGT
GAACGTGTCACTCTCTCAACCTCCACTTTTCCAGACGTGTCTGCCCCTCCACAGAATATTGACGGCGGTGAGACG
GTGGTGGACGACCAGAGCGTCTTCTCATGGCGTGATGGAAACAACGATCCTTCTAATAGGGAAGGTCAAAACCTG
CTTAACCTGCTTTATCATATTGCCGAGGATCAGGCGCGGAGGGACGGCTATATCCATCGTGGGGTTACTTGCAAC
AGCTGTGGTGCCATGCCGATTCAGGGTATCAGATACCGATGTGCCAATTGCATCGACTACGATCTCTGTGAGACG
TGCGAGGCAATGCAGGTCCATATCAAAACACATTTGTTCTACAAAGTGCGGATTCCAGCCCCATTCTTAGGAAAC
CCTCGTCAATCCCAGCCTGTATGGTATCCCGGGAAGCCTTCAATGCTCCCGCGCAGTCTTCCACGCCCTCTTGCC
AAGCGTCTTATGAAAGACTGCAATTTCGAAAATACGGAGCTTGATGCACTCTGGGATCAGTTCCGCTGTTTGGCC
AATTATGAGTGGGCAAATGACCCAAACAAGTTGCATATGGCCATCGATCGCAAAACATTCGACCGATGCTTTGTG
CCTAATACTTCTATCCGGCCGCCGCCCCCGAGTCTCATTTACGACCGAATGTTCGCATTCTATGACACCAATGGC
GACAATCTTATCGGGTTCGAGGAATTCCTGAAGGGCTTGGCCAGTCTCAACAACAAAAGCAACGACGAACGGCTG
CGACGGGTGTTCCGCGGCTACGACATCGATGGAGATGGCTTTGTCGAACGCAAGGACTTCCTTCGGGTTTTCAGG
GCATACTATGCGCTGAGCCGAGAGCTTACAAGGGACATGGTTGCTGGCATGGAGGATGACTTCCTAGAGGGTGGA
GCCCGTGATGTGGTACTTGGTAGCCAGCCTATCAGCTCTGCATTCCCTGGTAGCATCCCTTCAGGTGAACGTTCT
CGCACAGGAGAAGGCAAGAGCATGAATTCCGAGGGGGACATGGAAATCATTGACAACGAAGGAATCTTGCGACAG
GACGGAGATGATACTGGTGATCGGCATTTGGTCGTGGGTGATGCTGCTGTCAGAGCACAATTTAGTCGAATGAGG
CCATTGTTCCCATCTACACTACGCCTAGCACCCGCCGAGACTACTCCTCGCCCGCCAGATGCCATAGAGAGTGAC
CAAAATGAAGACGACGAAGAAGAAGATGAGGATGGTGCTAGCGAGAGTGGATCAGACCAATCTAGCTCGTCGGTG
GCCAGTGGTACCTGGCCCCCAGTTGAACACATCCTCGAAGAAGATATTATTTCTGCTCTCGGGACCTATATTCCC
GCTCGGGAAATCACGGATCCAATTGATCGGGCTCGCGTCGCGGATGCTGTTTATCACAGAATGCGCGAAGATGAT
CAGAGACGTGTGTTTGACGCTCGTCAGCGTGGAATTGACGAACGTTGGAGGCGCCGCGCCTTCTATACAGACGAA
GAAGATGGCGCCACTATCCCTGCAGGGTATGAAAGGGATCCGGCCATTGATGACTTCAGCGATGATGAAGACCTT
AATGAATCGGTATCGCGCCCACCCTCTTTCCGTTCGCGGTCCTCGTCCAAGGTGCGATTCCAGGATGATCTCAAC
GACGATGAGTACGACATTCGATCTAACCCATCCACCTCGTCCCGGAGTATTCCTGTTGGCGAGCGATGGGGTGGC
TTTGAAATCCCAGAGGTCGAAAGGGACGTTGGGAAAGAAATCCTATATCAAGTCACGCAACAGGGATTCAACGAG
CTTCTAGATATTCTATTCAAGCCGAAAGAGGACCTTATGATGGAGGTCTATCGCACGAGAGCTGATCGCAAGTTG
TGGGCCCGCGAGATTGAACTCGCAGCAAAAGAGGACCCCTCGAAACGCACCACAACTGAGAATCCCCCAGTGGAG
GAGGAACTCGAGGAAATTATCAACAGTCAGCCACTTGATGATCTATTACAGCGCGCTGGTTACCAGATTCGGAGC
CCAGTCCTGGTACCTGAGAATACCGGACCAGTGCTAGCTCCGTCGCCGGGGCCCACCGTTTCAGATGAGGGTGAT
GAGGATGAGTATGAAGACGATGACGACGTGCGACCAACTCATCTCGCCGATCCCGGAAGAGATACTGGATTTGGG
CAAGCACGGCCATTTGTGGAATCCGCCACAACGTCCGCCACTTCGTCTGATTATGGCGATGATATCGCTGCCTCT
GCGTCTGGTGTGGGGCCATCCAGCCCGGTTGTTGAAGAGGAAAGACTCCACTGCGATCCAACTCTCCCACAGCAT
CGTCCCGACGAGCCATTCGTGATGACCCAGGAAGTGATTGCTGAATCAGACTCCGACTTGGAGGAATCACCAATT
AGGAACACAAACCCTGATCTCCCTGATCGGTTCCGACTCCAGCCCGGGACCATCTCTCTTCCCGCCCCATCTTCT
CCCCGCTCCTCCCCAGAAGCCGAAGCCACAGCCCCCAAGCTTCCTCCTTCTCCTATGCAACCACTCCCACCTCCT
CATCGGGTCAATGACCTGCCTCGTGACACTGCCCCACGCCGACCTTCGCCCCGGACCCTAGCTCGGTGGGTCTAT
TTAGACCAGGTGGAACGTGAAAACAAGGAACGTGGTCACGGTGCGAGACTTAACTTTGAAGAGTTCTCGCGCCGT
ATGGCTGCTGATCGAGGGCGCCGACTCGCATTTGTGGCCAGTTGGATTGAGATGGCTAGCTTTTGA
Gene >Pro_DTO377G3_2|g3076.t1
ATGTCCGACTCGCGCCCAGGGCCAGTCTCACTAGCACGATATCGACCTATCCTCTACCTCTTCACTGGTGTCGCT
GCTGCCTATGCGATTCTCTATGTTCACAACAATGTCATCTCGCAGCCATCATCAAGTTCACTCCGACGTCGAAAT
GCTGTGCGCCGGACGAGACCAACCGAAGCCGAAGAACCTGGGATCGCTGATACTCCGTCTTATCGAGCTATTACC
CACCTTGAACAGCTAGAGCATCAGAATGGTGTATATGGGACATTTCGCATCGAGACGGAGGATGGGCGTCGCGTG
GAGAGCGGTCTTCTTCCATCACTCCTCGCAACACGCGACCAGCTAATGGAAGAAGTGGGCGTCCCGCCTGCTCAT
GCAGAGCGCATGCGCGAGATGATGGAGGATACATTTCTTGAATCCTTCCTTGCACTCGATTTCCCGTCTGCACAT
ATTCTCCCAGAGGATACCGCAGAAAGAACATACCTGACAGAACAACTTCAACGCCGAGGTATCTCCCGAGCTGGT
ATTGAAAGGGCTCTGGTCCGGTTCAACGGAGATACGAACTACGGCGAAGAGCTGCGTCGGCGACGACAGAACGGT
GAACGTGTCACTCTCTCAACCTCCACTTTTCCAGACGTGTCTGCCCCTCCACAGAATATTGACGGCGGTGAGACG
GTGGTGGACGACCAGAGCGTCTTCTCATGGCGTGATGGAAACAACGATCCTTCTAATAGGGAAGGTCAAAACCTG
CTTAACCTGCTTTATCATATTGCCGAGGATCAGGCGCGGAGGGACGGCTATATCCATCGTGGGGTTACTTGCAAC
AGCTGTGGTGCCATGCCGATTCAGGGTATCAGATACCGATGTGCCAATTGCATCGACTACGATCTCTGTGAGACG
TGCGAGGCAATGCAGGTCCATATCAAAACACATTTGTTCTACAAAGTGCGGATTCCAGCCCCATTCTTAGGAAAC
CCTCGTCAATCCCAGCCTGTATGGTATCCCGGGAAGCCTTCAATGCTCCCGCGCAGTCTTCCACGCCCTCTTGCC
AAGCGTCTTATGAAAGACTGCAATTTCGAAAATACGGAGCTTGATGCACTCTGGGATCAGTTCCGCTGTTTGGCC
AATTATGAGTGGGCAAATGACCCAAACAAGTTGCATATGGCCATCGATCGCAAAACATTCGACCGATGCTTTGTG
CCTAATACTTCTATCCGGCCGCCGCCCCCGAGTCTCATTTACGACCGAATGTTCGCATTCTATGACACCAATGGC
GACAATCTTATCGGGTTCGAGGAATTCCTGAAGGGCTTGGCCAGTCTCAACAACAAAAGCAACGACGAACGGCTG
CGACGGGTGTTCCGCGGCTACGACATCGATGGAGATGGCTTTGTCGAACGCAAGGACTTCCTTCGGGTTTTCAGG
GCATACTATGCGCTGAGCCGAGAGCTTACAAGGGACATGGTTGCTGGCATGGAGGATGACTTCCTAGAGGGTGGA
GCCCGTGATGTGGTACTTGGTAGCCAGCCTATCAGCTCTGCATTCCCTGGTAGCATCCCTTCAGGTGAACGTTCT
CGCACAGGAGAAGGCAAGAGCATGAATTCCGAGGGGGACATGGAAATCATTGACAACGAAGGAATCTTGCGACAG
GACGGAGATGATACTGGTGATCGGCATTTGGTCGTGGGTGATGCTGCTGTCAGAGCACAATTTAGTCGAATGAGG
CCATTGTTCCCATCTACACTACGCCTAGCACCCGCCGAGACTACTCCTCGCCCGCCAGATGCCATAGAGAGTGAC
CAAAATGAAGACGACGAAGAAGAAGATGAGGATGGTGCTAGCGAGAGTGGATCAGACCAATCTAGCTCGTCGGTG
GCCAGTGGTACCTGGCCCCCAGTTGAACACATCCTCGAAGAAGATATTATTTCTGCTCTCGGGACCTATATTCCC
GCTCGGGAAATCACGGATCCAATTGATCGGGCTCGCGTCGCGGATGCTGTTTATCACAGAATGCGCGAAGATGAT
CAGAGACGTGTGTTTGACGCTCGTCAGCGTGGAATTGACGAACGTTGGAGGCGCCGCGCCTTCTATACAGACGAA
GAAGATGGCGCCACTATCCCTGCAGGGTATGAAAGGGATCCGGCCATTGATGACTTCAGCGATGATGAAGACCTT
AATGAATCGGTATCGCGCCCACCCTCTTTCCGTTCGCGGTCCTCGTCCAAGGTGCGATTCCAGGATGATCTCAAC
GACGATGAGTACGACATTCGATCTAACCCATCCACCTCGTCCCGGAGTATTCCTGTTGGCGAGCGATGGGGTGGC
TTTGAAATCCCAGAGGTCGAAAGGGACGTTGGGAAAGAAATCCTATATCAAGTCACGCAACAGGGATTCAACGAG
CTTCTAGATATTCTATTCAAGCCGAAAGAGGACCTTATGATGGAGGTCTATCGCACGAGAGCTGATCGCAAGTTG
TGGGCCCGCGAGATTGAACTCGCAGCAAAAGAGGACCCCTCGAAACGCACCACAACTGAGAATCCCCCAGTGGAG
GAGGAACTCGAGGAAATTATCAACAGTCAGCCACTTGATGATCTATTACAGCGCGCTGGTTACCAGATTCGGAGC
CCAGTCCTGGTACCTGAGAATACCGGACCAGTGCTAGCTCCGTCGCCGGGGCCCACCGTTTCAGATGAGGGTGAT
GAGGATGAGTATGAAGACGATGACGACGTGCGACCAACTCATCTCGCCGATCCCGGAAGAGATACTGGATTTGGG
CAAGCACGGCCATTTGTGGAATCCGCCACAACGTCCGCCACTTCGTCTGATTATGGCGATGATATCGCTGCCTCT
GCGTCTGGTGTGGGGCCATCCAGCCCGGTTGTTGAAGAGGAAAGACTCCACTGCGATCCAACTCTCCCACAGCAT
CGTCCCGACGAGCCATTCGTGATGACCCAGGAAGTGATTGCTGAATCAGACTCCGACTTGGAGGAATCACCAATT
AGGAACACAAACCCTGATCTCCCTGATCGGTTCCGACTCCAGCCCGGGACCATCTCTCTTCCCGCCCCATCTTCT
CCCCGCTCCTCCCCAGAAGCCGAAGCCACAGCCCCCAAGCTTCCTCCTTCTCCTATGCAACCACTCCCACCTCCT
CATCGGGTCAATGACCTGCCTCGTGACACTGCCCCACGCCGACCTTCGCCCCGGACCCTAGCTCGGTGGGTCTAT
TTAGACCAGGTGGAACGTGAAAACAAGGAACGTGGTCACGGTGCGAGACTTAACTTTGAAGAGTTCTCGCGCCGT
ATGGCTGCTGATCGAGGGCGCCGACTCGCATTTGTGGCCAGTTGGATTGAGATGGCTAGCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail