Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3072.t1
Gene name
Locationscaffold_04:632943..634148
Strand+
Gene length (bp)1205
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 9.1E-50 9 273
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.9E-38 8 236
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 4.0E-18 9 338
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.7E-14 7 268
PF13460 NAD_binding_10 NAD(P)H-binding 2.7E-12 12 184
PF07993 NAD_binding_4 Male sterility protein 6.1E-09 74 226
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 4.7E-08 8 127
PF08659 KR KR domain 4.0E-07 8 134
PF02254 TrkA_N TrkA-N domain 2.8E-06 13 80

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0003824 catalytic activity Yes
GO:0006813 potassium ion transport Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0050662 coenzyme binding Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008610 lipid biosynthetic process No
GO:0030001 metal ion transport No
GO:0016229 steroid dehydrogenase activity No
GO:0051234 establishment of localization No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0051179 localization No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0044238 primary metabolic process No
GO:0006812 cation transport No
GO:0008202 steroid metabolic process No
GO:0006810 transport No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0006811 ion transport No
GO:0015672 monovalent inorganic cation transport No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0048037 cofactor binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3072.t1
MTDTARKVLISGGTGFVGSAVVRALAEKYPNFIIAVIDQNPPRAEHVLPEITTWIQVDITSTETLSKAFEAVKPD
IVIHTAGVVPDLAERFGRRLEQEVWKINFEGTRNILDISKHSGVEVFIYTSSCCVVIDDTRTAHPNINEEWPSAF
RSTIYGESKAAAEALVLNASSSKMVTCALRPSVLCGPGDYQLLPAIHACIAKYETPFLIGDGFNLWDITHVDNAA
DAHILAIENLLSSRTAAGEAFFIQNNEPIAFRDFCLAIWAHFGHVPPFQMHIPKSLAYFTGLVCETVTWLTGTTT
TLSRGSVQDACAIRYASGNKAKEILGYEARIGIEEAIRLSCEDYASRLGFELPPQ*
Coding >Pro_DTO377G3_2|g3072.t1
ATGACTGACACAGCGAGGAAAGTCCTGATATCTGGTGGCACGGGTTTTGTAGGCTCGGCCGTGGTACGGGCTCTT
GCAGAAAAATACCCAAACTTTATCATCGCCGTCATCGACCAAAACCCTCCACGAGCCGAGCACGTCCTGCCAGAA
ATAACTACGTGGATTCAGGTGGATATTACTTCAACTGAAACATTGAGCAAAGCATTTGAGGCTGTGAAGCCAGAT
ATCGTTATCCACACTGCTGGAGTCGTCCCAGATCTGGCCGAACGGTTTGGTCGCCGACTAGAACAGGAGGTATGG
AAGATCAACTTTGAAGGCACACGGAATATTCTGGATATATCCAAGCACAGCGGGGTTGAAGTATTCATATACACG
AGCAGTTGCTGTGTGGTGATCGACGATACGCGTACCGCTCATCCTAACATCAATGAAGAATGGCCCTCGGCATTT
AGGTCAACCATTTATGGAGAGTCCAAGGCTGCTGCAGAAGCACTCGTTCTAAATGCCTCAAGCAGTAAAATGGTG
ACATGTGCCCTCCGGCCATCGGTACTATGCGGACCAGGAGACTACCAGCTATTACCAGCTATTCACGCATGTATC
GCCAAATACGAAACCCCTTTTTTGATCGGAGATGGCTTCAACCTATGGGATATCACCCATGTCGACAATGCCGCC
GATGCTCATATCCTAGCCATAGAGAATCTGCTATCATCTCGCACGGCTGCAGGCGAGGCATTTTTCATTCAGAAT
AACGAACCTATCGCCTTTCGTGATTTTTGTCTGGCAATTTGGGCGCATTTTGGGCATGTCCCTCCTTTTCAAATG
CATATCCCTAAGAGTCTGGCTTACTTCACCGGGTTGGTGTGTGAGACTGTCACCTGGTTGACGGGAACAACGACA
ACTTTGAGCCGTGGAAGTGTACAAGATGCATGCGCCATTCGATATGCCAGTGGCAACAAAGCCAAGGAGATTCTG
GGGTACGAGGCGCGCATAGGTATCGAGGAAGCCATCCGTTTGAGTTGCGAGGATTATGCTTCTCGTCTCGGGTTC
GAATTGCCTCCTCAATAG
Transcript >Pro_DTO377G3_2|g3072.t1
ATGACTGACACAGCGAGGAAAGTCCTGATATCTGGTGGCACGGGTTTTGTAGGCTCGGCCGTGGTACGGGCTCTT
GCAGAAAAATACCCAAACTTTATCATCGCCGTCATCGACCAAAACCCTCCACGAGCCGAGCACGTCCTGCCAGAA
ATAACTACGTGGATTCAGGTGGATATTACTTCAACTGAAACATTGAGCAAAGCATTTGAGGCTGTGAAGCCAGAT
ATCGTTATCCACACTGCTGGAGTCGTCCCAGATCTGGCCGAACGGTTTGGTCGCCGACTAGAACAGGAGGTATGG
AAGATCAACTTTGAAGGCACACGGAATATTCTGGATATATCCAAGCACAGCGGGGTTGAAGTATTCATATACACG
AGCAGTTGCTGTGTGGTGATCGACGATACGCGTACCGCTCATCCTAACATCAATGAAGAATGGCCCTCGGCATTT
AGGTCAACCATTTATGGAGAGTCCAAGGCTGCTGCAGAAGCACTCGTTCTAAATGCCTCAAGCAGTAAAATGGTG
ACATGTGCCCTCCGGCCATCGGTACTATGCGGACCAGGAGACTACCAGCTATTACCAGCTATTCACGCATGTATC
GCCAAATACGAAACCCCTTTTTTGATCGGAGATGGCTTCAACCTATGGGATATCACCCATGTCGACAATGCCGCC
GATGCTCATATCCTAGCCATAGAGAATCTGCTATCATCTCGCACGGCTGCAGGCGAGGCATTTTTCATTCAGAAT
AACGAACCTATCGCCTTTCGTGATTTTTGTCTGGCAATTTGGGCGCATTTTGGGCATGTCCCTCCTTTTCAAATG
CATATCCCTAAGAGTCTGGCTTACTTCACCGGGTTGGTGTGTGAGACTGTCACCTGGTTGACGGGAACAACGACA
ACTTTGAGCCGTGGAAGTGTACAAGATGCATGCGCCATTCGATATGCCAGTGGCAACAAAGCCAAGGAGATTCTG
GGGTACGAGGCGCGCATAGGTATCGAGGAAGCCATCCGTTTGAGTTGCGAGGATTATGCTTCTCGTCTCGGGTTC
GAATTGCCTCCTCAATAG
Gene >Pro_DTO377G3_2|g3072.t1
ATGACTGACACAGCGAGGAAAGTCCTGATATCTGGTGGCACGGGTTTTGTAGGCTCGGCCGTGGTACGGGCTCTT
GCAGAAAAATACCCAAACTTTATCATCGCCGTCATCGACCAAAACCCTCCACGAGCCGAGCACGTCCTGCCAGAA
ATAACTACGTGGATTCAGGTGGATATTACTTCAACTGAAACATTGAGCAAAGCATTTGAGGCTGTGAAGCCAGAT
ATCGTTATCCACACTGCTGGAGTCGTCCCAGATCTGGCCGAACGGTTTGGTCGCCGACTAGAACAGGAGGTATGG
AAGATCAACTTTGAAGGCACACGGAATATTCTGGATATATCCAAGCACAGCGGGGTTGAAGTATTCATATACACG
AGCAGTTGCTGTGTGGTGATCGACGATACGCGTACCGCTCATCCTAACATCAATGAAGAATGGCCCTCGGCATTT
AGGTCAACCATTTATGGAGAGTCCAAGGTTGGAACTACCAATCCCATCAGCAAGATTCACGGCATCGATATGAGA
TATATAACTAACACGATTTGGGATGGTCACTAGGCTGCTGCAGAAGCACTCGTTCTAAATGCCTCAAGCAGTAAA
ATGGTGACATGTGCCCTCCGGCCATCGGTACTATGCGGACCAGGAGACTACCAGCTATTACCAGCTATTCACGCA
TGTATCGCCAAATACGAAACCCCTTTTTTGATCGGAGATGGCTTCAACCTATGGGATATCACCCATGTCGACAAT
GCCGCCGATGCTCATATCCTAGCCATAGAGAATCTGCTATCATCTCGCACGGCTGCAGGCGAGGCATTTTTCATT
CAGAATAACGAACCTATCGCCTTTCGTGATTTTTGTCTGGCAATTTGGGCGCATTTTGGGCATGTCCCTCCTTTT
CAAATGCATATCCCTAAGAGTCTGGCTTACTTCACCGGGTTGGTGTGTGAGACTGTCACCTGGTTGACGGGAACA
ACGACAACTTTGAGCCGTGGAAGTGTACAAGATGCATGCGCCATTCGATATGCCAGTGGCAACAAAGCCAAGGAG
ATTCTGGGGTACGAGGCGCGCATAGGTATCGAGGAAGCCATCCGTTTGAGTTGCGAGGTAAGTAAACACCAAGCG
TAACCTTTTCTATTGCCGTACTCACCAAAGCAATTTAGGATTATGCTTCTCGTCTCGGGTTCGAATTGCCTCCTC
AATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail