Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3064.t1
Gene name
Locationscaffold_04:618044..619340
Strand+
Gene length (bp)1296
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 3.3E-61 69 409

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.44 0.73 6.16
5d_25C Five days - 25 degrees Celsius 1.48 0.03 2.93
7d_25C Seven days - 25 degrees Celsius 1.54 0.04 3.03
10d_25C Ten days - 25 degrees Celsius 1.25 0.09 2.42
7d_15C Seven days - 15 degrees Celsius 1.96 0.15 3.77
7d_30C Seven days - 30 degrees Celsius 2.44 0.46 4.43

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.101006 no
3d_25C 7d_25C 0.101148 no
3d_25C 7d_15C 0.285720 no
3d_25C 7d_30C 0.512600 no
3d_25C 10d_25C 0.028871 yes
5d_25C 7d_25C 0.963940 no
5d_25C 7d_15C 0.690875 no
5d_25C 7d_30C 0.376011 no
5d_25C 10d_25C 0.824242 no
7d_25C 7d_15C 0.732208 no
7d_25C 7d_30C 0.400368 no
7d_25C 10d_25C 0.772694 no
7d_15C 7d_30C 0.733670 no
7d_15C 10d_25C 0.454517 no
7d_30C 10d_25C 0.171107 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3064.t1
MRLKLSAISLIASCGSLCSATDRVLKHGSPESVGLLAEPLKEMPLNLSQYTVAANYGAFTYDLVHPVQPGGSVVV
GHKATIVSSFAFGHTNMYADSNGTLLPHAKWTPNHIDTIYDMASLTKVFTAVAALRAIDEGKLSLYRTVASYIPE
FATNGKENITILMLVTHTSGFPPDPLPGLYDPSYTTMQQRVNAVLEQALQDAPGSTYTYSDLNFMNLRFVLEKVT
GKPFDEYVNEYTSELGMTSTFFNKGNNQSPSFHYYSRMAPTEYQIEVLGDDEPKRPQPVRGTVHDENAWSLNGVS
GHAGLFSTAGDVAILCQMILNNGTYGGKRILKPETVDLMFHNFNTKFPGDEHSVGFELNQNYFSGPMANMLAGGH
TGFTGTTLVVDRASDTFMVMMAHRVYPSRTWSSNNIVREAVGYWVARALGRDVAFP*
Coding >Pro_DTO377G3_2|g3064.t1
ATGAGACTCAAGCTTTCAGCCATTTCCCTCATTGCAAGCTGCGGCTCGCTGTGCAGTGCCACAGACCGTGTCCTC
AAGCATGGCTCTCCTGAATCAGTGGGACTTCTTGCCGAGCCTCTCAAGGAGATGCCGCTCAACTTGAGCCAGTAC
ACTGTTGCTGCCAATTATGGAGCATTCACCTACGATTTGGTTCACCCCGTCCAGCCGGGAGGCTCCGTTGTCGTC
GGTCACAAGGCCACCATTGTGAGCTCCTTCGCTTTCGGCCATACGAACATGTATGCAGACTCCAATGGCACATTG
CTCCCTCACGCAAAGTGGACCCCGAACCACATCGACACCATCTACGATATGGCCAGTCTGACTAAAGTGTTCACT
GCGGTGGCCGCATTGCGCGCCATTGACGAGGGCAAGCTCAGCTTGTACAGAACCGTTGCCTCCTATATCCCCGAG
TTCGCGACCAATGGAAAGGAAAACATCACTATCCTGATGCTGGTGACCCACACAAGTGGCTTCCCTCCTGACCCT
CTGCCCGGTCTGTATGATCCATCTTACACGACCATGCAGCAGCGTGTCAATGCCGTCCTCGAGCAAGCCCTCCAG
GATGCTCCTGGATCTACCTACACCTACTCTGACTTGAACTTCATGAACCTGCGCTTCGTGTTGGAGAAGGTCACC
GGTAAACCATTCGATGAGTATGTCAATGAGTACACCAGCGAGCTCGGCATGACCAGCACCTTCTTCAACAAGGGA
AACAACCAGTCCCCTTCATTCCATTACTACTCGCGCATGGCACCGACTGAGTACCAGATCGAAGTTCTGGGAGAC
GACGAGCCCAAGCGTCCTCAGCCCGTGCGTGGAACCGTGCACGACGAGAATGCCTGGTCTCTTAACGGTGTGAGC
GGACACGCCGGTCTCTTCTCGACCGCCGGTGACGTGGCAATCCTCTGCCAGATGATCCTCAACAACGGTACCTAT
GGCGGCAAGCGGATCCTGAAGCCGGAGACTGTCGACTTGATGTTCCACAACTTCAACACCAAATTCCCTGGTGAT
GAGCACAGTGTCGGCTTCGAGCTCAACCAGAACTACTTCTCCGGACCCATGGCCAATATGCTTGCTGGAGGCCAC
ACTGGCTTTACTGGTACCACGCTTGTTGTTGATCGCGCATCGGACACCTTCATGGTCATGATGGCCCACCGTGTG
TATCCCAGCCGTACCTGGTCGAGTAACAACATTGTTCGGGAGGCGGTAGGCTATTGGGTCGCCCGTGCGCTTGGT
CGGGATGTTGCCTTCCCTTGA
Transcript >Pro_DTO377G3_2|g3064.t1
ATGAGACTCAAGCTTTCAGCCATTTCCCTCATTGCAAGCTGCGGCTCGCTGTGCAGTGCCACAGACCGTGTCCTC
AAGCATGGCTCTCCTGAATCAGTGGGACTTCTTGCCGAGCCTCTCAAGGAGATGCCGCTCAACTTGAGCCAGTAC
ACTGTTGCTGCCAATTATGGAGCATTCACCTACGATTTGGTTCACCCCGTCCAGCCGGGAGGCTCCGTTGTCGTC
GGTCACAAGGCCACCATTGTGAGCTCCTTCGCTTTCGGCCATACGAACATGTATGCAGACTCCAATGGCACATTG
CTCCCTCACGCAAAGTGGACCCCGAACCACATCGACACCATCTACGATATGGCCAGTCTGACTAAAGTGTTCACT
GCGGTGGCCGCATTGCGCGCCATTGACGAGGGCAAGCTCAGCTTGTACAGAACCGTTGCCTCCTATATCCCCGAG
TTCGCGACCAATGGAAAGGAAAACATCACTATCCTGATGCTGGTGACCCACACAAGTGGCTTCCCTCCTGACCCT
CTGCCCGGTCTGTATGATCCATCTTACACGACCATGCAGCAGCGTGTCAATGCCGTCCTCGAGCAAGCCCTCCAG
GATGCTCCTGGATCTACCTACACCTACTCTGACTTGAACTTCATGAACCTGCGCTTCGTGTTGGAGAAGGTCACC
GGTAAACCATTCGATGAGTATGTCAATGAGTACACCAGCGAGCTCGGCATGACCAGCACCTTCTTCAACAAGGGA
AACAACCAGTCCCCTTCATTCCATTACTACTCGCGCATGGCACCGACTGAGTACCAGATCGAAGTTCTGGGAGAC
GACGAGCCCAAGCGTCCTCAGCCCGTGCGTGGAACCGTGCACGACGAGAATGCCTGGTCTCTTAACGGTGTGAGC
GGACACGCCGGTCTCTTCTCGACCGCCGGTGACGTGGCAATCCTCTGCCAGATGATCCTCAACAACGGTACCTAT
GGCGGCAAGCGGATCCTGAAGCCGGAGACTGTCGACTTGATGTTCCACAACTTCAACACCAAATTCCCTGGTGAT
GAGCACAGTGTCGGCTTCGAGCTCAACCAGAACTACTTCTCCGGACCCATGGCCAATATGCTTGCTGGAGGCCAC
ACTGGCTTTACTGGTACCACGCTTGTTGTTGATCGCGCATCGGACACCTTCATGGTCATGATGGCCCACCGTGTG
TATCCCAGCCGTACCTGGTCGAGTAACAACATTGTTCGGGAGGCGGTAGGCTATTGGGTCGCCCGTGCGCTTGGT
CGGGATGTTGCCTTCCCTTGA
Gene >Pro_DTO377G3_2|g3064.t1
ATGAGACTCAAGCTTTCAGCCATTTCCCTCATTGCAAGCTGCGGCTCGCTGTGCAGTGCCACAGACCGTGTCCTC
AAGCATGGCTCTCCTGAATCAGTGGGACTTCTTGCCGAGCCTCTCAAGGAGATGCCGCTCAACTTGAGCCAGTAC
ACTGTTGCTGCCAATTATGGAGCATTCACCTACGATTTGGTTCACCCCGTCCAGCCGGGAGGCTCCGTTGTCGTC
GGTCACAAGGCCACCATTGTGAGCTCCTTCGCTTTCGGCCATACGAACATGTATGCAGACTCCAATGGCACATTG
CTCCCTCACGCAAAGTGGACCCCGAACCACATCGACACCATCTACGATATGGCCAGTCTGACTAAAGTGTTCACT
GCGGTGGCCGCATTGCGCGCCATTGACGAGGGCAAGCTCAGCTTGTACAGAACCGTTGCCTCCTATATCCCCGAG
TTCGCGACCAATGGAAAGGAAAACATCACTATCCTGATGCTGGTGACCCACACAAGTGGCTTCCCTCCTGACCCT
CTGCCCGGTCTGTATGATCCATCTTACACGACCATGCAGCAGCGTGTCAATGCCGTCCTCGAGCAAGCCCTCCAG
GATGCTCCTGGATCTACCTACACCTACTCTGACTTGAACTTCATGAACCTGCGCTTCGTGTTGGAGAAGGTCACC
GGTAAACCATTCGATGAGTATGTCAATGAGTACACCAGCGAGCTCGGCATGACCAGCACCTTCTTCAACAAGGGA
AACAACCAGTCCCCTTCATTCCATTACTACTCGCGCATGGCACCGACTGAGTACCAGATCGAAGTTCTGGGAGAC
GACGAGCCCAAGCGTCCTCAGCCCGTGCGTGGAACCGTGCACGACGAGAATGCCTGGTCTCTTAACGGTGTGAGC
GGACACGCCGGTCTCTTCTCGACCGCCGGTGACGTGGCAATCCTCTGCCAGATGATCCTCAACAACGGTACCTAT
GGCGGCAAGCGGATCCTGAAGCCGGAGACTGTCGACTTGATGTTCCACAACTTCAACACCAAATTCCCTGGTGAT
GAGCACAGTGTCGGCTTCGAGCTCAACCAGAACTACTTCTCCGGACCCATGGCCAATATGCTTGCTGGAGGCCAC
ACTGGCTTTACTGGTACCACGCTTGTTGTTGATCGCGCATCGGACACCTTCATGGTCATGATGGCCCACCGTGTG
TATCCCAGCCGTACCTGGTCGAGTAACAACATTGTTCGGGAGGCGGTAGGCTATTGGGTCGCCCGTGCGCTTGGT
CGGGATGTTGCCTTCCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail