Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3054.t1
Gene name
Locationscaffold_04:585486..586572
Strand+
Gene length (bp)1086
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.3E-49 9 255

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 162 184 22
3 196 218 22
4 238 260 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 55.23 31.31 79.15
5d_25C Five days - 25 degrees Celsius 30.40 14.56 46.24
7d_25C Seven days - 25 degrees Celsius 43.92 20.36 67.48
10d_25C Ten days - 25 degrees Celsius 36.99 17.29 56.70
7d_15C Seven days - 15 degrees Celsius 34.01 13.61 54.41
7d_30C Seven days - 30 degrees Celsius 44.95 22.91 67.00

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.016634 yes
3d_25C 7d_25C 0.462462 no
3d_25C 7d_15C 0.101883 no
3d_25C 7d_30C 0.486244 no
3d_25C 10d_25C 0.144882 no
5d_25C 7d_25C 0.243117 no
5d_25C 7d_15C 0.796541 no
5d_25C 7d_30C 0.176783 no
5d_25C 10d_25C 0.584060 no
7d_25C 7d_15C 0.487809 no
7d_25C 7d_30C 0.960243 no
7d_25C 10d_25C 0.650092 no
7d_15C 7d_30C 0.420406 no
7d_15C 10d_25C 0.856965 no
7d_30C 10d_25C 0.573286 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3054.t1
MGKAGRVACIFTPYVLTIASLICIILVGLGCTKASSSTLNNLYFIRLDLSNISEGSALTSEITDRLSAAGITDVT
ADEVSETIETLQADANISDFYDIGLWGYCEGNITNSTDTVSSCTDPKAEFYFNPSTILGVSETELEKEIGSDLKK
TMKIYKAVSKWMFIAYLVAFIATCAQVLLGIFAIFSRWGSCVTTIVSIVSFLFTLGASLTSTIMFSIAKSSLGTV
LEVYGIDVSLGKNIYAATWLAVAFSLGATFFWMLSTCCCSGRSPYGHRDRSPRGITAEKAPYTYEPIGAAHPPFG
SQQPLVPQHGYSTSYPAATHNNDIPMTHNNQQSSAYEPFRHA*
Coding >Pro_DTO377G3_2|g3054.t1
ATGGGAAAAGCTGGTCGTGTCGCGTGTATCTTCACGCCCTATGTCTTGACCATCGCATCATTGATCTGCATCATT
TTGGTGGGATTGGGCTGCACAAAAGCCAGTTCTTCGACCTTGAATAATCTATACTTCATTCGTCTCGACCTCTCG
AACATAAGTGAAGGATCGGCACTTACATCAGAAATCACAGATCGCCTCAGTGCTGCCGGTATCACTGATGTCACT
GCGGATGAGGTCTCGGAGACCATCGAAACACTGCAGGCTGATGCCAATATTTCTGATTTCTACGACATCGGTCTC
TGGGGTTACTGCGAGGGAAATATCACCAACAGCACGGATACCGTCTCCAGCTGCACAGACCCCAAGGCCGAGTTC
TACTTCAACCCGTCTACAATCCTAGGAGTGAGCGAGACCGAGCTTGAGAAGGAGATTGGCAGCGACCTGAAGAAG
ACCATGAAAATTTACAAGGCTGTCTCCAAGTGGATGTTCATTGCCTACCTAGTCGCGTTTATTGCCACTTGCGCC
CAGGTCCTGCTTGGTATCTTCGCCATCTTCAGCCGCTGGGGCAGCTGCGTCACCACGATTGTCTCGATTGTTTCG
TTCCTCTTCACCCTTGGCGCATCGCTTACCTCGACTATCATGTTCTCGATCGCAAAAAGCTCCCTCGGCACAGTC
CTCGAGGTCTATGGTATCGATGTAAGCCTGGGTAAGAACATATACGCCGCCACCTGGCTCGCAGTCGCTTTCTCT
CTGGGAGCCACCTTCTTCTGGATGCTCAGCACCTGCTGTTGCTCCGGCCGCTCGCCCTACGGCCACAGGGACCGC
AGCCCCCGCGGCATCACCGCAGAGAAGGCCCCCTACACTTATGAGCCCATCGGTGCCGCCCACCCACCCTTCGGT
TCTCAGCAGCCCCTTGTTCCCCAACACGGCTACAGCACCTCTTACCCTGCTGCCACCCACAACAACGATATCCCC
ATGACCCACAACAACCAGCAGTCAAGCGCCTACGAGCCATTCCGCCATGCTTAA
Transcript >Pro_DTO377G3_2|g3054.t1
ATGGGAAAAGCTGGTCGTGTCGCGTGTATCTTCACGCCCTATGTCTTGACCATCGCATCATTGATCTGCATCATT
TTGGTGGGATTGGGCTGCACAAAAGCCAGTTCTTCGACCTTGAATAATCTATACTTCATTCGTCTCGACCTCTCG
AACATAAGTGAAGGATCGGCACTTACATCAGAAATCACAGATCGCCTCAGTGCTGCCGGTATCACTGATGTCACT
GCGGATGAGGTCTCGGAGACCATCGAAACACTGCAGGCTGATGCCAATATTTCTGATTTCTACGACATCGGTCTC
TGGGGTTACTGCGAGGGAAATATCACCAACAGCACGGATACCGTCTCCAGCTGCACAGACCCCAAGGCCGAGTTC
TACTTCAACCCGTCTACAATCCTAGGAGTGAGCGAGACCGAGCTTGAGAAGGAGATTGGCAGCGACCTGAAGAAG
ACCATGAAAATTTACAAGGCTGTCTCCAAGTGGATGTTCATTGCCTACCTAGTCGCGTTTATTGCCACTTGCGCC
CAGGTCCTGCTTGGTATCTTCGCCATCTTCAGCCGCTGGGGCAGCTGCGTCACCACGATTGTCTCGATTGTTTCG
TTCCTCTTCACCCTTGGCGCATCGCTTACCTCGACTATCATGTTCTCGATCGCAAAAAGCTCCCTCGGCACAGTC
CTCGAGGTCTATGGTATCGATGTAAGCCTGGGTAAGAACATATACGCCGCCACCTGGCTCGCAGTCGCTTTCTCT
CTGGGAGCCACCTTCTTCTGGATGCTCAGCACCTGCTGTTGCTCCGGCCGCTCGCCCTACGGCCACAGGGACCGC
AGCCCCCGCGGCATCACCGCAGAGAAGGCCCCCTACACTTATGAGCCCATCGGTGCCGCCCACCCACCCTTCGGT
TCTCAGCAGCCCCTTGTTCCCCAACACGGCTACAGCACCTCTTACCCTGCTGCCACCCACAACAACGATATCCCC
ATGACCCACAACAACCAGCAGTCAAGCGCCTACGAGCCATTCCGCCATGCTTAA
Gene >Pro_DTO377G3_2|g3054.t1
ATGGGAAAAGCTGGTCGTGTCGCGTGTATCTTCACGCCCTATGTCTTGACCATCGCATCATTGATCTGCATCATT
TTGGTGGGATTGGGCTGCACAAAAGCCAGTTCTTCGACCTTGAATAATCTATACTTCATTCGTGTAAGTGATCAA
AGATTCTACATGGTTACTGCATCCGCTAATGCCAATAATCTATAGCTCGACCTCTCGAACATAAGTGAAGGATCG
GCACTTACATCAGAAATCACAGATCGCCTCAGTGCTGCCGGTATCACTGATGTCACTGCGGATGAGGTCTCGGAG
ACCATCGAAACACTGCAGGCTGATGCCAATATTTCTGATTTCTACGACATCGGTCTCTGGGGTTACTGCGAGGGA
AATATCACCAACAGCACGGATACCGTCTCCAGCTGCACAGACCCCAAGGCCGAGTTCTACTTCAACCCGTCTACA
ATCCTAGGAGTGAGCGAGACCGAGCTTGAGAAGGAGATTGGCAGCGACCTGAAGAAGACCATGAAAATTTACAAG
GCTGTCTCCAAGTGGATGTTCATTGCCTACCTAGTCGCGTTTATTGCCACTTGCGCCCAGGTCCTGCTTGGTATC
TTCGCCATCTTCAGCCGCTGGGGCAGCTGCGTCACCACGATTGTCTCGATTGTTTCGTTCCTCTTCACCCTTGGC
GCATCGCTTACCTCGACTATCATGTTCTCGATCGCAAAAAGCTCCCTCGGCACAGTCCTCGAGGTCTATGGTATC
GATGTAAGCCTGGGTAAGAACATATACGCCGCCACCTGGCTCGCAGTCGCTTTCTCTCTGGGAGCCACCTTCTTC
TGGATGCTCAGCACCTGCTGTTGCTCCGGCCGCTCGCCCTACGGCCACAGGGACCGCAGCCCCCGCGGCATCACC
GCAGAGAAGGCCCCCTACACTTATGAGCCCATCGGTGCCGCCCACCCACCCTTCGGTTCTCAGCAGCCCCTTGTT
CCCCAACACGGCTACAGCACCTCTTACCCTGCTGCCACCCACAACAACGATATCCCCATGACCCACAACAACCAG
CAGTCAAGCGCCTACGAGCCATTCCGCCATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail