Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3054.t1
Gene name
Locationscaffold_04:585486..586572
Strand+
Gene length (bp)1086
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.3E-49 9 255

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 162 184 22
3 196 218 22
4 238 260 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3054.t1
MGKAGRVACIFTPYVLTIASLICIILVGLGCTKASSSTLNNLYFIRLDLSNISEGSALTSEITDRLSAAGITDVT
ADEVSETIETLQADANISDFYDIGLWGYCEGNITNSTDTVSSCTDPKAEFYFNPSTILGVSETELEKEIGSDLKK
TMKIYKAVSKWMFIAYLVAFIATCAQVLLGIFAIFSRWGSCVTTIVSIVSFLFTLGASLTSTIMFSIAKSSLGTV
LEVYGIDVSLGKNIYAATWLAVAFSLGATFFWMLSTCCCSGRSPYGHRDRSPRGITAEKAPYTYEPIGAAHPPFG
SQQPLVPQHGYSTSYPAATHNNDIPMTHNNQQSSAYEPFRHA*
Coding >Pro_DTO377G3_2|g3054.t1
ATGGGAAAAGCTGGTCGTGTCGCGTGTATCTTCACGCCCTATGTCTTGACCATCGCATCATTGATCTGCATCATT
TTGGTGGGATTGGGCTGCACAAAAGCCAGTTCTTCGACCTTGAATAATCTATACTTCATTCGTCTCGACCTCTCG
AACATAAGTGAAGGATCGGCACTTACATCAGAAATCACAGATCGCCTCAGTGCTGCCGGTATCACTGATGTCACT
GCGGATGAGGTCTCGGAGACCATCGAAACACTGCAGGCTGATGCCAATATTTCTGATTTCTACGACATCGGTCTC
TGGGGTTACTGCGAGGGAAATATCACCAACAGCACGGATACCGTCTCCAGCTGCACAGACCCCAAGGCCGAGTTC
TACTTCAACCCGTCTACAATCCTAGGAGTGAGCGAGACCGAGCTTGAGAAGGAGATTGGCAGCGACCTGAAGAAG
ACCATGAAAATTTACAAGGCTGTCTCCAAGTGGATGTTCATTGCCTACCTAGTCGCGTTTATTGCCACTTGCGCC
CAGGTCCTGCTTGGTATCTTCGCCATCTTCAGCCGCTGGGGCAGCTGCGTCACCACGATTGTCTCGATTGTTTCG
TTCCTCTTCACCCTTGGCGCATCGCTTACCTCGACTATCATGTTCTCGATCGCAAAAAGCTCCCTCGGCACAGTC
CTCGAGGTCTATGGTATCGATGTAAGCCTGGGTAAGAACATATACGCCGCCACCTGGCTCGCAGTCGCTTTCTCT
CTGGGAGCCACCTTCTTCTGGATGCTCAGCACCTGCTGTTGCTCCGGCCGCTCGCCCTACGGCCACAGGGACCGC
AGCCCCCGCGGCATCACCGCAGAGAAGGCCCCCTACACTTATGAGCCCATCGGTGCCGCCCACCCACCCTTCGGT
TCTCAGCAGCCCCTTGTTCCCCAACACGGCTACAGCACCTCTTACCCTGCTGCCACCCACAACAACGATATCCCC
ATGACCCACAACAACCAGCAGTCAAGCGCCTACGAGCCATTCCGCCATGCTTAA
Transcript >Pro_DTO377G3_2|g3054.t1
ATGGGAAAAGCTGGTCGTGTCGCGTGTATCTTCACGCCCTATGTCTTGACCATCGCATCATTGATCTGCATCATT
TTGGTGGGATTGGGCTGCACAAAAGCCAGTTCTTCGACCTTGAATAATCTATACTTCATTCGTCTCGACCTCTCG
AACATAAGTGAAGGATCGGCACTTACATCAGAAATCACAGATCGCCTCAGTGCTGCCGGTATCACTGATGTCACT
GCGGATGAGGTCTCGGAGACCATCGAAACACTGCAGGCTGATGCCAATATTTCTGATTTCTACGACATCGGTCTC
TGGGGTTACTGCGAGGGAAATATCACCAACAGCACGGATACCGTCTCCAGCTGCACAGACCCCAAGGCCGAGTTC
TACTTCAACCCGTCTACAATCCTAGGAGTGAGCGAGACCGAGCTTGAGAAGGAGATTGGCAGCGACCTGAAGAAG
ACCATGAAAATTTACAAGGCTGTCTCCAAGTGGATGTTCATTGCCTACCTAGTCGCGTTTATTGCCACTTGCGCC
CAGGTCCTGCTTGGTATCTTCGCCATCTTCAGCCGCTGGGGCAGCTGCGTCACCACGATTGTCTCGATTGTTTCG
TTCCTCTTCACCCTTGGCGCATCGCTTACCTCGACTATCATGTTCTCGATCGCAAAAAGCTCCCTCGGCACAGTC
CTCGAGGTCTATGGTATCGATGTAAGCCTGGGTAAGAACATATACGCCGCCACCTGGCTCGCAGTCGCTTTCTCT
CTGGGAGCCACCTTCTTCTGGATGCTCAGCACCTGCTGTTGCTCCGGCCGCTCGCCCTACGGCCACAGGGACCGC
AGCCCCCGCGGCATCACCGCAGAGAAGGCCCCCTACACTTATGAGCCCATCGGTGCCGCCCACCCACCCTTCGGT
TCTCAGCAGCCCCTTGTTCCCCAACACGGCTACAGCACCTCTTACCCTGCTGCCACCCACAACAACGATATCCCC
ATGACCCACAACAACCAGCAGTCAAGCGCCTACGAGCCATTCCGCCATGCTTAA
Gene >Pro_DTO377G3_2|g3054.t1
ATGGGAAAAGCTGGTCGTGTCGCGTGTATCTTCACGCCCTATGTCTTGACCATCGCATCATTGATCTGCATCATT
TTGGTGGGATTGGGCTGCACAAAAGCCAGTTCTTCGACCTTGAATAATCTATACTTCATTCGTGTAAGTGATCAA
AGATTCTACATGGTTACTGCATCCGCTAATGCCAATAATCTATAGCTCGACCTCTCGAACATAAGTGAAGGATCG
GCACTTACATCAGAAATCACAGATCGCCTCAGTGCTGCCGGTATCACTGATGTCACTGCGGATGAGGTCTCGGAG
ACCATCGAAACACTGCAGGCTGATGCCAATATTTCTGATTTCTACGACATCGGTCTCTGGGGTTACTGCGAGGGA
AATATCACCAACAGCACGGATACCGTCTCCAGCTGCACAGACCCCAAGGCCGAGTTCTACTTCAACCCGTCTACA
ATCCTAGGAGTGAGCGAGACCGAGCTTGAGAAGGAGATTGGCAGCGACCTGAAGAAGACCATGAAAATTTACAAG
GCTGTCTCCAAGTGGATGTTCATTGCCTACCTAGTCGCGTTTATTGCCACTTGCGCCCAGGTCCTGCTTGGTATC
TTCGCCATCTTCAGCCGCTGGGGCAGCTGCGTCACCACGATTGTCTCGATTGTTTCGTTCCTCTTCACCCTTGGC
GCATCGCTTACCTCGACTATCATGTTCTCGATCGCAAAAAGCTCCCTCGGCACAGTCCTCGAGGTCTATGGTATC
GATGTAAGCCTGGGTAAGAACATATACGCCGCCACCTGGCTCGCAGTCGCTTTCTCTCTGGGAGCCACCTTCTTC
TGGATGCTCAGCACCTGCTGTTGCTCCGGCCGCTCGCCCTACGGCCACAGGGACCGCAGCCCCCGCGGCATCACC
GCAGAGAAGGCCCCCTACACTTATGAGCCCATCGGTGCCGCCCACCCACCCTTCGGTTCTCAGCAGCCCCTTGTT
CCCCAACACGGCTACAGCACCTCTTACCCTGCTGCCACCCACAACAACGATATCCCCATGACCCACAACAACCAG
CAGTCAAGCGCCTACGAGCCATTCCGCCATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail