Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g304.t1
Gene name
Locationscaffold_01:772346..775036
Strand+
Gene length (bp)2690
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05786 Cnd2 Condensin complex subunit 2 0.0E+00 15 847

GO

GO Term Description Terminal node
GO:0000796 condensin complex Yes
GO:0007076 mitotic chromosome condensation Yes
GO:0022402 cell cycle process No
GO:0008150 biological_process No
GO:0051276 chromosome organization No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0005575 cellular_component No
GO:1903047 mitotic cell cycle process No
GO:0071840 cellular component organization or biogenesis No
GO:0030261 chromosome condensation No
GO:0044815 DNA packaging complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g304.t1
MPRVANKVHRRSNGNSTPHKNTPVKIPLNDDEGEKAARMEARQALHDRQMSQIKAAVKTPMPPRRYTLDREESDS
PVTPRASHHRSRTSDVNGRAVTPMKRVPILANFEEWMKMATDNKINANNSWNFALIDYFHDMSLLKEGDGVNFQK
ASCTLDGCVKIYTSRVDSVATETGKLLSGLADSRDKRGRGEEDAEDGDEDEEGEDGQPRRSRKKTRSHEATLAPS
FSSLQLKKFELEFAVDPLFKKASADFDEGGAKGLLLNHLAIDSHGRIVFDSSDDAVDDSAKTSEDDRQESTDPDQ
QTDDQAKPNQKPASDTFENNTEIDLATLASRFFPDLDRLDEQDICPSLKNLDLGDPSGSLDLPLLKAPEEWRQDK
MDEDGRAHDDPSGIMLDDDNAVGFDDDDATLAGFDLSGDTGFGDGGEVWAREAALEPMLNVHRTTHDGDNDGEGD
DGNEDAYAISMSHQTNSHDHENILSYFDNALQKNWAGPEHWKIRRIKEHATPATSAPKQRKEKEPFEIDFAAPLD
PAVAELIYTPASSNSAVSLPKTQWKTKGRNLLPDDKHFNSRNLLTLFLKPKAKMGSKKILGKRRRQDLTAGNGDM
DEAFWANRKPEENAGEEGAAGAYDANFFADDDGLAFPNGMDLDDDDNLPFADAREMLSPPADGTAGTSAGEAGGA
TGLSALLNMVGATPGRPGAGGYGSQLVTQGGRRARPDYVAYARVAKKVDVRRLKTEMWKGMGERLVDAVDFASAS
QPGAVSSDAPTEPESESDAPVPPTPKGESPEQVGGRLRFTQIMNSLKEVYPTETLRDISTSFGFICLLHLANEQG
LVLESDLSKMGNDAATLEEIFVSRDTHAIIEEGGGM*
Coding >Pro_DTO377G3_2|g304.t1
ATGCCGCGTGTCGCAAACAAGGTACATCGCCGCTCTAACGGCAACTCGACCCCGCACAAAAACACACCGGTCAAG
ATACCCCTCAACGATGATGAGGGCGAGAAGGCAGCGCGTATGGAGGCTCGTCAAGCACTTCATGATCGCCAAATG
AGTCAGATTAAAGCGGCAGTCAAGACGCCTATGCCACCCCGTCGGTACACCCTCGATCGTGAAGAGAGCGACAGT
CCCGTAACTCCTCGAGCCTCACATCATCGCAGTCGCACCAGCGATGTCAATGGCCGTGCAGTGACACCGATGAAG
CGCGTGCCTATCTTGGCTAATTTTGAAGAATGGATGAAGATGGCGACTGATAACAAAATCAATGCGAATAACTCC
TGGAACTTTGCGCTGATCGACTATTTTCACGACATGTCATTACTGAAGGAAGGAGATGGTGTAAACTTCCAAAAG
GCTAGTTGCACCCTTGACGGTTGTGTTAAAATCTACACCAGCCGAGTGGACAGTGTTGCAACAGAGACGGGGAAA
CTTCTGAGTGGACTGGCTGATAGTCGCGACAAGAGAGGGCGCGGGGAGGAGGATGCAGAGGATGGCGATGAGGAT
GAAGAAGGCGAGGATGGTCAGCCTCGCAGGTCGCGGAAAAAGACACGTTCCCATGAGGCTACCCTCGCGCCGTCA
TTTTCGTCATTGCAACTAAAGAAGTTCGAGCTAGAGTTCGCCGTGGACCCTCTATTCAAAAAAGCATCGGCGGAC
TTTGATGAAGGAGGCGCCAAAGGCTTACTTCTGAACCACCTTGCTATTGATAGCCATGGAAGAATTGTTTTCGAT
AGCAGCGACGATGCTGTGGATGATAGTGCAAAAACCTCCGAAGATGACCGTCAAGAATCTACGGATCCTGACCAG
CAGACCGATGACCAAGCAAAACCAAACCAGAAACCCGCAAGCGACACATTTGAGAATAACACGGAGATCGACCTT
GCTACACTAGCAAGCCGATTTTTCCCAGATCTAGATCGCCTAGATGAACAAGATATTTGTCCATCGCTTAAAAAC
CTCGACTTGGGTGACCCCAGCGGGTCGCTGGATCTCCCTCTCCTCAAAGCGCCAGAGGAATGGCGGCAAGACAAG
ATGGACGAAGATGGACGAGCACATGATGACCCATCTGGTATCATGCTGGACGACGACAACGCTGTCGGGTTTGAT
GACGATGATGCTACCCTAGCCGGATTTGATCTCAGCGGCGACACTGGGTTTGGTGACGGAGGAGAGGTATGGGCT
CGGGAAGCCGCCTTGGAACCAATGTTGAATGTTCACCGGACCACCCACGATGGGGATAATGATGGTGAGGGTGAC
GATGGCAATGAAGACGCATATGCCATCTCCATGTCTCATCAAACTAATAGTCACGACCACGAGAATATTCTTAGC
TACTTTGACAACGCGCTACAGAAGAACTGGGCTGGCCCAGAGCACTGGAAGATTCGAAGAATCAAAGAACATGCC
ACACCCGCTACGTCGGCGCCCAAGCAGCGCAAAGAAAAAGAGCCATTTGAGATTGATTTCGCTGCCCCTCTGGAT
CCTGCTGTCGCGGAATTGATCTACACCCCGGCCAGCTCCAACTCCGCCGTTTCATTACCCAAGACGCAGTGGAAA
ACAAAGGGTCGCAACCTTCTTCCCGATGACAAGCATTTCAACTCCCGTAACCTACTCACATTGTTCCTCAAGCCG
AAGGCAAAGATGGGCTCAAAGAAGATTTTGGGCAAACGCCGCCGGCAGGATTTGACGGCTGGTAATGGAGATATG
GACGAGGCATTCTGGGCAAATCGCAAGCCGGAAGAAAACGCCGGCGAGGAAGGTGCCGCAGGTGCCTATGATGCC
AATTTCTTTGCTGATGACGATGGTCTTGCTTTCCCGAACGGCATGGATCTCGATGACGACGACAATCTACCATTC
GCGGATGCCCGGGAGATGCTCTCTCCGCCAGCAGACGGGACTGCAGGCACATCGGCTGGAGAAGCAGGTGGAGCA
ACTGGACTCAGCGCGCTTTTGAATATGGTTGGCGCCACGCCTGGCCGACCGGGAGCTGGTGGCTACGGATCGCAA
TTGGTGACACAAGGCGGTCGTCGTGCACGACCAGACTACGTGGCGTATGCACGTGTGGCAAAGAAGGTTGACGTT
CGGCGTCTTAAAACCGAGATGTGGAAGGGCATGGGTGAGCGCCTGGTTGATGCCGTAGACTTTGCCTCAGCTTCA
CAGCCAGGAGCCGTGTCCAGTGATGCTCCGACCGAACCCGAGAGTGAATCGGATGCCCCTGTCCCGCCTACACCC
AAGGGTGAAAGCCCAGAGCAGGTGGGTGGTCGGCTACGGTTCACGCAAATTATGAACTCCCTCAAGGAAGTCTAC
CCGACTGAGACTCTACGCGATATCAGCACCTCATTCGGGTTTATTTGTCTTCTGCATCTTGCCAACGAACAGGGC
CTCGTGCTGGAGAGTGATCTTAGCAAGATGGGCAATGATGCGGCTACCCTAGAGGAGATCTTCGTAAGTAGGGAT
ACGCACGCTATCATCGAAGAGGGAGGAGGGATGTGA
Transcript >Pro_DTO377G3_2|g304.t1
ATGCCGCGTGTCGCAAACAAGGTACATCGCCGCTCTAACGGCAACTCGACCCCGCACAAAAACACACCGGTCAAG
ATACCCCTCAACGATGATGAGGGCGAGAAGGCAGCGCGTATGGAGGCTCGTCAAGCACTTCATGATCGCCAAATG
AGTCAGATTAAAGCGGCAGTCAAGACGCCTATGCCACCCCGTCGGTACACCCTCGATCGTGAAGAGAGCGACAGT
CCCGTAACTCCTCGAGCCTCACATCATCGCAGTCGCACCAGCGATGTCAATGGCCGTGCAGTGACACCGATGAAG
CGCGTGCCTATCTTGGCTAATTTTGAAGAATGGATGAAGATGGCGACTGATAACAAAATCAATGCGAATAACTCC
TGGAACTTTGCGCTGATCGACTATTTTCACGACATGTCATTACTGAAGGAAGGAGATGGTGTAAACTTCCAAAAG
GCTAGTTGCACCCTTGACGGTTGTGTTAAAATCTACACCAGCCGAGTGGACAGTGTTGCAACAGAGACGGGGAAA
CTTCTGAGTGGACTGGCTGATAGTCGCGACAAGAGAGGGCGCGGGGAGGAGGATGCAGAGGATGGCGATGAGGAT
GAAGAAGGCGAGGATGGTCAGCCTCGCAGGTCGCGGAAAAAGACACGTTCCCATGAGGCTACCCTCGCGCCGTCA
TTTTCGTCATTGCAACTAAAGAAGTTCGAGCTAGAGTTCGCCGTGGACCCTCTATTCAAAAAAGCATCGGCGGAC
TTTGATGAAGGAGGCGCCAAAGGCTTACTTCTGAACCACCTTGCTATTGATAGCCATGGAAGAATTGTTTTCGAT
AGCAGCGACGATGCTGTGGATGATAGTGCAAAAACCTCCGAAGATGACCGTCAAGAATCTACGGATCCTGACCAG
CAGACCGATGACCAAGCAAAACCAAACCAGAAACCCGCAAGCGACACATTTGAGAATAACACGGAGATCGACCTT
GCTACACTAGCAAGCCGATTTTTCCCAGATCTAGATCGCCTAGATGAACAAGATATTTGTCCATCGCTTAAAAAC
CTCGACTTGGGTGACCCCAGCGGGTCGCTGGATCTCCCTCTCCTCAAAGCGCCAGAGGAATGGCGGCAAGACAAG
ATGGACGAAGATGGACGAGCACATGATGACCCATCTGGTATCATGCTGGACGACGACAACGCTGTCGGGTTTGAT
GACGATGATGCTACCCTAGCCGGATTTGATCTCAGCGGCGACACTGGGTTTGGTGACGGAGGAGAGGTATGGGCT
CGGGAAGCCGCCTTGGAACCAATGTTGAATGTTCACCGGACCACCCACGATGGGGATAATGATGGTGAGGGTGAC
GATGGCAATGAAGACGCATATGCCATCTCCATGTCTCATCAAACTAATAGTCACGACCACGAGAATATTCTTAGC
TACTTTGACAACGCGCTACAGAAGAACTGGGCTGGCCCAGAGCACTGGAAGATTCGAAGAATCAAAGAACATGCC
ACACCCGCTACGTCGGCGCCCAAGCAGCGCAAAGAAAAAGAGCCATTTGAGATTGATTTCGCTGCCCCTCTGGAT
CCTGCTGTCGCGGAATTGATCTACACCCCGGCCAGCTCCAACTCCGCCGTTTCATTACCCAAGACGCAGTGGAAA
ACAAAGGGTCGCAACCTTCTTCCCGATGACAAGCATTTCAACTCCCGTAACCTACTCACATTGTTCCTCAAGCCG
AAGGCAAAGATGGGCTCAAAGAAGATTTTGGGCAAACGCCGCCGGCAGGATTTGACGGCTGGTAATGGAGATATG
GACGAGGCATTCTGGGCAAATCGCAAGCCGGAAGAAAACGCCGGCGAGGAAGGTGCCGCAGGTGCCTATGATGCC
AATTTCTTTGCTGATGACGATGGTCTTGCTTTCCCGAACGGCATGGATCTCGATGACGACGACAATCTACCATTC
GCGGATGCCCGGGAGATGCTCTCTCCGCCAGCAGACGGGACTGCAGGCACATCGGCTGGAGAAGCAGGTGGAGCA
ACTGGACTCAGCGCGCTTTTGAATATGGTTGGCGCCACGCCTGGCCGACCGGGAGCTGGTGGCTACGGATCGCAA
TTGGTGACACAAGGCGGTCGTCGTGCACGACCAGACTACGTGGCGTATGCACGTGTGGCAAAGAAGGTTGACGTT
CGGCGTCTTAAAACCGAGATGTGGAAGGGCATGGGTGAGCGCCTGGTTGATGCCGTAGACTTTGCCTCAGCTTCA
CAGCCAGGAGCCGTGTCCAGTGATGCTCCGACCGAACCCGAGAGTGAATCGGATGCCCCTGTCCCGCCTACACCC
AAGGGTGAAAGCCCAGAGCAGGTGGGTGGTCGGCTACGGTTCACGCAAATTATGAACTCCCTCAAGGAAGTCTAC
CCGACTGAGACTCTACGCGATATCAGCACCTCATTCGGGTTTATTTGTCTTCTGCATCTTGCCAACGAACAGGGC
CTCGTGCTGGAGAGTGATCTTAGCAAGATGGGCAATGATGCGGCTACCCTAGAGGAGATCTTCGTAAGTAGGGAT
ACGCACGCTATCATCGAAGAGGGAGGAGGGATGTGA
Gene >Pro_DTO377G3_2|g304.t1
ATGCCGCGTGTCGCAAACAAGGTACATCGCCGCTCTAACGGCAACTCGACCCCGCACAAAAACACACCGGTCAAG
TACGGATCTGGATATCTCCTGGTTATCGCATTGAACTAATTATATCAGGATACCCCTCAACGATGATGAGGGCGA
GAAGGCAGCGCGTATGGAGGCTCGTCAAGCACTTCATGATCGCCAAATGAGTCAGATTAAAGCGGCAGTCAAGAC
GCCTATGCCACCCCGTCGGTACACCCTCGATCGTGAAGAGAGCGACAGTCCCGTAACTCCTCGAGCCTCACATCA
TCGCAGTCGCACCAGCGATGTCAATGGCCGTGCAGTGACACCGATGAAGCGCGTGCCTATCTTGGCTAATTTTGA
AGAATGGATGAAGATGGCGACTGATAACAAAATCAATGCGAATAACTCCTGGAACTTTGCGCTGATCGACTATTT
TCACGACATGTCATTACTGAAGGAAGGAGATGGTGTAAACTTCCAAAAGGCTAGTTGCACCCTTGACGGTTGTGT
TAAAATCTACACCAGCCGAGTGGACAGTGTTGCAACAGAGACGGGGAAACTTCTGAGTGGACTGGCTGATAGTCG
CGACAAGAGAGGGCGCGGGGAGGAGGATGCAGAGGATGGCGATGAGGATGAAGAAGGCGAGGATGGTCAGCCTCG
CAGGTCGCGGAAAAAGGTATGGTCTATACGGTGTCAGAGATTTGGGATTTTGACTAACTAGATGTGTCTAGACAC
GTTCCCATGAGGCTACCCTCGCGCCGTCATTTTCGTCATTGCAACTAAAGAAGTTCGAGCTAGAGTTCGCCGTGG
ACCCTCTATTCAAAAAAGCATCGGCGGACTTTGATGAAGGAGGCGCCAAAGGCTTACTTCTGAACCACCTTGCTA
TTGATAGCCATGGAAGAATTGTTTTCGATAGCAGCGACGATGCTGTGGATGATAGTGCAAAAACCTCCGAAGATG
ACCGTCAAGAATCTACGGATCCTGACCAGCAGACCGATGACCAAGCAAAACCAAACCAGAAACCCGCAAGCGACA
CATTTGAGAATAACACGGAGATCGACCTTGCTACACTAGCAAGCCGATTTTTCCCAGATCTAGATCGCCTAGATG
AACAAGATATTTGTCCATCGCTTAAAAACCTCGACTTGGGTGACCCCAGCGGGTCGCTGGATCTCCCTCTCCTCA
AAGCGCCAGAGGAATGGCGGCAAGACAAGATGGACGAAGATGGACGAGCACATGATGACCCATCTGGTATCATGC
TGGACGACGACAACGCTGTCGGGTTTGATGACGATGATGCTACCCTAGCCGGATTTGATCTCAGCGGCGACACTG
GGTTTGGTGACGGAGGAGAGGTATGGGCTCGGGAAGCCGCCTTGGAACCAATGTTGAATGTTCACCGGACCACCC
ACGATGGGGATAATGATGGTGAGGGTGACGATGGCAATGAAGACGCATATGCCATCTCCATGTCTCATCAAACTA
ATAGTCACGACCACGAGAATATTCTTAGCTACTTTGACAACGCGCTACAGAAGAACTGGGCTGGCCCAGAGCACT
GGAAGATTCGAAGAATCAAAGAACATGCCACACCCGCTACGTCGGCGCCCAAGCAGCGCAAAGAAAAAGAGCCAT
TTGAGATTGATTTCGCTGCCCCTCTGGATCCTGCTGTCGCGGAATTGATCTACACCCCGGCCAGCTCCAACTCCG
CCGTTTCATTACCCAAGACGCAGTGGAAAACAAAGGGTCGCAACCTTCTTCCCGATGACAAGCATTTCAACTCCC
GTAACCTACTCACATTGTTCCTCAAGCCGAAGGCAAAGATGGGCTCAAAGAAGATTTTGGGCAAACGCCGCCGGC
AGGATTTGACGGCTGGTAATGGAGATATGGACGAGGCATTCTGGGCAAATCGCAAGCCGGAAGAAAACGCCGGCG
AGGAAGGTGCCGCAGGTGCCTATGATGCCAATTTCTTTGCTGATGACGATGGTCTTGCTTTCCCGAACGGCATGG
ATCTCGATGACGACGACAATCTACCATTCGCGGATGCCCGGGAGATGCTCTCTCCGCCAGCAGACGGGACTGCAG
GCACATCGGCTGGAGAAGCAGGTGGAGCAACTGGACTCAGCGCGCTTTTGAATATGGTTGGCGCCACGCCTGGCC
GACCGGGAGCTGGTGGCTACGGATCGCAATTGGTGACACAAGGCGGTCGTCGTGCACGACCAGACTACGTGGCGT
ATGCACGTGTGGCAAAGAAGGTTGACGTTCGGCGTCTTAAAACCGAGATGTGGAAGGGCATGGGTGAGCGCCTGG
TTGATGCCGTAGACTTTGCCTCAGCTTCACAGCCAGGAGCCGTGTCCAGTGATGCTCCGACCGAACCCGAGAGTG
AATCGGATGCCCCTGTCCCGCCTACACCCAAGGGTGAAAGCCCAGAGCAGGTGGGTGGTCGGCTACGGTTCACGC
AAATTATGAACTCCCTCAAGGAAGTCTACCCGACTGAGACTCTACGCGATATCAGCACCTCATTCGGGTTTATTT
GTCTTCTGCATCTTGCCAACGAACAGGGCCTCGTGCTGGAGAGTGATCTTAGCAAGATGGGCAATGATGCGGCTA
CCCTAGAGGAGATCTTCGTAAGTAGGGATACGCACGCTATCATCGAAGAGGGAGGAGGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail