Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3015.t1
Gene name
Locationscaffold_04:473191..478273
Strand-
Gene length (bp)5082
Transcript length (bp)3510
Coding sequence length (bp)3510
Protein length (aa) 1170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.0E-54 818 1078
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.7E-20 820 1033

GO

GO Term Description Terminal node
GO:0004672 protein kinase activity Yes
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0000166 nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0036211 protein modification process No
GO:0097367 carbohydrate derivative binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0043167 ion binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016310 phosphorylation No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 111.09 65.43 156.75
5d_25C Five days - 25 degrees Celsius 135.22 78.73 191.70
7d_25C Seven days - 25 degrees Celsius 130.51 75.41 185.61
10d_25C Ten days - 25 degrees Celsius 139.72 80.64 198.80
7d_15C Seven days - 15 degrees Celsius 161.58 89.90 233.25
7d_30C Seven days - 30 degrees Celsius 108.35 63.61 153.08

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.450140 no
3d_25C 7d_25C 0.565160 no
3d_25C 7d_15C 0.115001 no
3d_25C 7d_30C 0.943709 no
3d_25C 10d_25C 0.372732 no
5d_25C 7d_25C 0.925634 no
5d_25C 7d_15C 0.528476 no
5d_25C 7d_30C 0.393114 no
5d_25C 10d_25C 0.929735 no
7d_25C 7d_15C 0.440160 no
7d_25C 7d_30C 0.491754 no
7d_25C 10d_25C 0.840231 no
7d_15C 7d_30C 0.093107 no
7d_15C 10d_25C 0.633340 no
7d_30C 10d_25C 0.313947 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3015.t1
MHLTVEMKRLIIPNREPSPLSSPLGPLSESPESESGYNLSLQTDQLRSSAGSVSSGYEPLSRSPLFDSDHGIGPS
GLDRIRQNQPSRVLTLPNMSSSSLSLAPMTGQRPSPSPRSRSSSRAHTNLLSSRSFTDLADLHRFPLESLHSFSF
AQQSEEFLHSRQNILKRSVDFMRDRMGWAATNAAIASAQANASGDTEMQAQDPQRLIATISSRRPSQTAIPPRSQ
LLSPVPSDRISNQRRDLVSAPTSRRVSLKPQPYTSSADPFASLNPSSAGLGFQIPALHAHSSKWTPASQAVFRTE
AKEPWTILAANDLSCLIFGVLQSEVRHLSILEVVQKEHQEWLKAKLRDPSTDVAARMPLQPERANISAVNPKYRG
LGNGVTAQLLSKPSSREQSRRAQTDDGYGSSTRNARNNNHPANKSRGVLLCGDVVPIQKRNGSRGSASVWVMEKR
GGLIWVLEEITENIAFIECDDSWKVVSAKGEVEKIWGPSVVQKGQSITDLLPCLPSESLETSLEKGLAKIVELRH
FAARTAAGVCIPVAVGKGEGDYTMQVSSFPHVAGMMVLSSSSLNVISSNSVFSSVLFGQERPEGLHITQLVPDFD
EMLDVLTEEDNVPLVDGIVIPEHSFRRARTLSILRDGKANAASVFTEPSGLLAKHRDGSTIVVDIQLRVVQSGTC
FSKDKTEKSSKSSKSSDRTSDSDESDDTVAVTELVYALWITYSRQLHAAGPAAGLSPSSVPSSKPTSPTHDPDSD
RPLDAGVAAQTENPKISVEIEAPTSALSQQLSEAASEPLTTRPPQPVPPVSAANAKNDPPAKRTINDYVILEEMG
QGAYGQVKLARLKKQPSKKMVLKFVTKKRILVDTWTRDRRLGTVPLEIHVLDFLRRDGLRHPNIVEMEGFFEDDI
NYYIEMTPHGLPGMDLFDYIELKANMDELECQNIFRQVASAINHLHTKALVVHRDIKDENVILDGEGRIKLIDFG
SAAYIKNGPFDVFVGTIDYAAPEALQGRSYRGKEQDIWALGILLYTIVYKENPFYNVDEILDHPLRIPFLPFSED
CIDLIRTMLDRDVDNRLTITEVLEHPWMVNIKKWFKHMPRYRIPSALHSAISCSSLHLSFSPPFATSPALCIFYS
ALSVLSVFCTVSLPKPVPRFLRRGPTTNNNGQYRSSLRSNTMPI*
Coding >Pro_DTO377G3_2|g3015.t1
ATGCATCTGACCGTGGAGATGAAGCGTCTGATCATTCCAAACCGCGAGCCGAGTCCTCTTTCGTCGCCGTTAGGA
CCTCTCTCTGAGTCGCCCGAATCCGAGTCCGGATACAACCTTTCTTTACAGACAGACCAACTCAGGAGCTCGGCG
GGCAGTGTTTCTTCGGGATACGAACCTCTCTCCAGATCCCCGTTATTCGACAGCGACCATGGAATTGGCCCATCT
GGACTGGATCGTATACGCCAAAATCAACCCTCGAGAGTACTGACCCTTCCAAACATGTCTTCCTCGTCGCTATCA
CTAGCACCTATGACTGGCCAGCGCCCCTCTCCCTCTCCCCGTTCTCGCTCATCTTCTCGAGCTCACACCAATCTT
TTGTCGAGCCGAAGTTTCACGGATCTAGCGGACCTACACCGGTTTCCACTGGAGTCGCTACACTCCTTTTCCTTT
GCCCAGCAGTCCGAGGAGTTTCTCCACAGCCGTCAGAACATTCTCAAAAGGTCTGTTGATTTCATGCGCGACCGG
ATGGGATGGGCCGCCACCAATGCCGCGATCGCCAGCGCACAAGCAAACGCCAGTGGGGACACGGAGATGCAAGCA
CAGGACCCGCAGAGATTAATAGCGACAATATCTTCGAGAAGGCCTTCGCAGACGGCAATTCCTCCCCGCTCCCAA
TTGTTGAGCCCGGTGCCCAGCGATCGTATCTCCAACCAAAGGAGGGACCTGGTCTCTGCACCTACATCCAGGCGC
GTAAGCTTAAAACCACAACCATACACCTCTTCCGCGGATCCTTTCGCCTCGCTCAATCCCTCGTCTGCTGGATTA
GGATTTCAGATCCCCGCCCTCCACGCCCATAGCAGCAAATGGACCCCGGCTTCCCAGGCCGTGTTTAGGACCGAA
GCCAAGGAACCATGGACCATTCTGGCCGCTAATGATTTGTCGTGTCTCATCTTTGGTGTTCTTCAGTCCGAAGTT
CGCCATCTCAGCATCCTGGAGGTTGTACAGAAAGAACACCAGGAATGGCTCAAGGCTAAACTTCGAGATCCTAGC
ACTGACGTCGCTGCCCGCATGCCACTTCAGCCCGAAAGAGCTAACATTTCCGCCGTCAATCCCAAGTACCGAGGT
CTTGGGAACGGAGTGACAGCACAACTCCTCAGCAAACCATCTTCACGAGAACAGTCCCGGAGAGCGCAGACTGAT
GACGGATATGGCTCCAGCACAAGAAACGCCCGAAACAACAACCACCCGGCCAATAAGTCACGCGGTGTCTTGCTG
TGCGGTGATGTGGTCCCGATTCAGAAGCGCAATGGGTCACGGGGATCCGCTAGCGTCTGGGTTATGGAAAAGCGT
GGTGGCCTGATCTGGGTCCTGGAAGAAATAACAGAGAATATTGCCTTCATCGAGTGTGATGATTCATGGAAAGTC
GTGAGTGCCAAAGGTGAAGTCGAAAAAATCTGGGGCCCATCTGTCGTTCAAAAAGGCCAGTCGATCACCGACCTT
TTACCTTGTTTGCCATCGGAATCTCTTGAGACATCCCTCGAGAAGGGATTGGCTAAAATCGTGGAGCTGAGGCAC
TTTGCCGCCCGCACTGCGGCTGGCGTTTGTATTCCCGTCGCGGTCGGCAAGGGAGAAGGAGATTACACTATGCAA
GTCTCCAGCTTTCCTCATGTCGCAGGCATGATGGTGCTCTCGTCCTCGTCATTGAACGTGATCAGCTCCAACTCT
GTGTTCTCTTCGGTTCTCTTCGGTCAAGAGAGACCGGAAGGACTTCACATCACTCAGCTTGTACCCGATTTCGAT
GAGATGCTAGACGTTTTGACCGAGGAGGACAACGTACCACTAGTTGATGGTATTGTCATACCGGAACACAGCTTC
CGGCGTGCACGGACACTTTCTATTCTCCGCGACGGAAAAGCAAATGCCGCCTCTGTGTTTACAGAGCCAAGTGGC
TTGCTTGCCAAGCATCGGGATGGCTCGACCATTGTCGTGGACATTCAACTGCGCGTGGTTCAGAGTGGCACCTGC
TTCTCAAAGGACAAGACAGAGAAAAGCAGCAAAAGCAGCAAAAGCAGTGATCGCACCAGTGACTCTGATGAGAGT
GATGATACCGTTGCAGTCACAGAGTTGGTCTATGCTTTGTGGATAACCTACTCGAGACAGCTCCACGCTGCTGGA
CCCGCTGCTGGCCTGTCGCCATCATCTGTCCCAAGTTCTAAGCCTACCTCACCCACACATGACCCTGATTCAGAT
CGCCCTTTAGACGCCGGTGTTGCTGCCCAGACGGAAAACCCCAAGATTTCTGTGGAGATTGAAGCTCCGACGTCA
GCACTTAGTCAACAACTCAGTGAGGCTGCCTCTGAGCCTCTGACCACCCGTCCCCCGCAGCCCGTTCCTCCGGTC
TCGGCTGCCAATGCGAAGAACGACCCTCCGGCGAAACGAACGATCAACGACTACGTGATTCTCGAAGAGATGGGA
CAAGGAGCCTACGGCCAAGTCAAACTGGCCCGTTTAAAGAAGCAGCCTAGCAAGAAGATGGTGTTGAAATTCGTC
ACGAAGAAGCGGATCCTGGTGGATACGTGGACTCGGGATCGGCGACTCGGGACTGTGCCATTGGAGATCCATGTT
CTGGACTTCCTACGGCGGGATGGGCTCAGGCACCCTAACATTGTGGAGATGGAAGGCTTCTTCGAGGACGATATC
AATTATTACATTGAAATGACTCCTCACGGGCTTCCGGGAATGGATCTGTTCGATTATATCGAGCTCAAGGCCAAC
ATGGACGAGCTGGAGTGCCAGAACATCTTCCGACAGGTTGCGAGCGCCATTAATCATCTCCACACCAAAGCCCTG
GTGGTACATCGTGACATCAAGGATGAGAATGTGATTCTCGATGGAGAGGGACGGATCAAGTTGATCGACTTTGGG
AGTGCGGCGTATATCAAAAACGGGCCATTTGATGTCTTTGTGGGAACCATTGATTATGCCGCGCCCGAGGCCTTA
CAGGGCCGGTCGTATCGAGGCAAGGAACAGGACATCTGGGCTCTAGGGATTCTCCTTTACACCATCGTCTACAAA
GAGAACCCGTTCTACAACGTCGATGAGATCCTTGACCACCCCCTCCGAATTCCTTTCCTTCCTTTCTCAGAAGAC
TGCATTGACCTCATCCGCACGATGCTCGATCGTGACGTTGACAACCGACTCACCATTACCGAAGTGCTTGAACAT
CCTTGGATGGTGAATATTAAGAAATGGTTCAAGCACATGCCTAGGTATCGCATTCCCTCCGCTCTGCATTCCGCC
ATTTCTTGTTCCTCTTTGCACCTCTCTTTCTCTCCTCCTTTCGCAACTTCCCCCGCCCTCTGTATCTTCTACTCG
GCTCTTTCGGTTCTCTCGGTTTTCTGTACGGTGTCTTTGCCGAAACCTGTTCCACGGTTCCTTCGCCGTGGCCCT
ACAACAAACAATAACGGTCAATACCGGTCATCCTTGAGATCGAACACTATGCCCATTTAA
Transcript >Pro_DTO377G3_2|g3015.t1
ATGCATCTGACCGTGGAGATGAAGCGTCTGATCATTCCAAACCGCGAGCCGAGTCCTCTTTCGTCGCCGTTAGGA
CCTCTCTCTGAGTCGCCCGAATCCGAGTCCGGATACAACCTTTCTTTACAGACAGACCAACTCAGGAGCTCGGCG
GGCAGTGTTTCTTCGGGATACGAACCTCTCTCCAGATCCCCGTTATTCGACAGCGACCATGGAATTGGCCCATCT
GGACTGGATCGTATACGCCAAAATCAACCCTCGAGAGTACTGACCCTTCCAAACATGTCTTCCTCGTCGCTATCA
CTAGCACCTATGACTGGCCAGCGCCCCTCTCCCTCTCCCCGTTCTCGCTCATCTTCTCGAGCTCACACCAATCTT
TTGTCGAGCCGAAGTTTCACGGATCTAGCGGACCTACACCGGTTTCCACTGGAGTCGCTACACTCCTTTTCCTTT
GCCCAGCAGTCCGAGGAGTTTCTCCACAGCCGTCAGAACATTCTCAAAAGGTCTGTTGATTTCATGCGCGACCGG
ATGGGATGGGCCGCCACCAATGCCGCGATCGCCAGCGCACAAGCAAACGCCAGTGGGGACACGGAGATGCAAGCA
CAGGACCCGCAGAGATTAATAGCGACAATATCTTCGAGAAGGCCTTCGCAGACGGCAATTCCTCCCCGCTCCCAA
TTGTTGAGCCCGGTGCCCAGCGATCGTATCTCCAACCAAAGGAGGGACCTGGTCTCTGCACCTACATCCAGGCGC
GTAAGCTTAAAACCACAACCATACACCTCTTCCGCGGATCCTTTCGCCTCGCTCAATCCCTCGTCTGCTGGATTA
GGATTTCAGATCCCCGCCCTCCACGCCCATAGCAGCAAATGGACCCCGGCTTCCCAGGCCGTGTTTAGGACCGAA
GCCAAGGAACCATGGACCATTCTGGCCGCTAATGATTTGTCGTGTCTCATCTTTGGTGTTCTTCAGTCCGAAGTT
CGCCATCTCAGCATCCTGGAGGTTGTACAGAAAGAACACCAGGAATGGCTCAAGGCTAAACTTCGAGATCCTAGC
ACTGACGTCGCTGCCCGCATGCCACTTCAGCCCGAAAGAGCTAACATTTCCGCCGTCAATCCCAAGTACCGAGGT
CTTGGGAACGGAGTGACAGCACAACTCCTCAGCAAACCATCTTCACGAGAACAGTCCCGGAGAGCGCAGACTGAT
GACGGATATGGCTCCAGCACAAGAAACGCCCGAAACAACAACCACCCGGCCAATAAGTCACGCGGTGTCTTGCTG
TGCGGTGATGTGGTCCCGATTCAGAAGCGCAATGGGTCACGGGGATCCGCTAGCGTCTGGGTTATGGAAAAGCGT
GGTGGCCTGATCTGGGTCCTGGAAGAAATAACAGAGAATATTGCCTTCATCGAGTGTGATGATTCATGGAAAGTC
GTGAGTGCCAAAGGTGAAGTCGAAAAAATCTGGGGCCCATCTGTCGTTCAAAAAGGCCAGTCGATCACCGACCTT
TTACCTTGTTTGCCATCGGAATCTCTTGAGACATCCCTCGAGAAGGGATTGGCTAAAATCGTGGAGCTGAGGCAC
TTTGCCGCCCGCACTGCGGCTGGCGTTTGTATTCCCGTCGCGGTCGGCAAGGGAGAAGGAGATTACACTATGCAA
GTCTCCAGCTTTCCTCATGTCGCAGGCATGATGGTGCTCTCGTCCTCGTCATTGAACGTGATCAGCTCCAACTCT
GTGTTCTCTTCGGTTCTCTTCGGTCAAGAGAGACCGGAAGGACTTCACATCACTCAGCTTGTACCCGATTTCGAT
GAGATGCTAGACGTTTTGACCGAGGAGGACAACGTACCACTAGTTGATGGTATTGTCATACCGGAACACAGCTTC
CGGCGTGCACGGACACTTTCTATTCTCCGCGACGGAAAAGCAAATGCCGCCTCTGTGTTTACAGAGCCAAGTGGC
TTGCTTGCCAAGCATCGGGATGGCTCGACCATTGTCGTGGACATTCAACTGCGCGTGGTTCAGAGTGGCACCTGC
TTCTCAAAGGACAAGACAGAGAAAAGCAGCAAAAGCAGCAAAAGCAGTGATCGCACCAGTGACTCTGATGAGAGT
GATGATACCGTTGCAGTCACAGAGTTGGTCTATGCTTTGTGGATAACCTACTCGAGACAGCTCCACGCTGCTGGA
CCCGCTGCTGGCCTGTCGCCATCATCTGTCCCAAGTTCTAAGCCTACCTCACCCACACATGACCCTGATTCAGAT
CGCCCTTTAGACGCCGGTGTTGCTGCCCAGACGGAAAACCCCAAGATTTCTGTGGAGATTGAAGCTCCGACGTCA
GCACTTAGTCAACAACTCAGTGAGGCTGCCTCTGAGCCTCTGACCACCCGTCCCCCGCAGCCCGTTCCTCCGGTC
TCGGCTGCCAATGCGAAGAACGACCCTCCGGCGAAACGAACGATCAACGACTACGTGATTCTCGAAGAGATGGGA
CAAGGAGCCTACGGCCAAGTCAAACTGGCCCGTTTAAAGAAGCAGCCTAGCAAGAAGATGGTGTTGAAATTCGTC
ACGAAGAAGCGGATCCTGGTGGATACGTGGACTCGGGATCGGCGACTCGGGACTGTGCCATTGGAGATCCATGTT
CTGGACTTCCTACGGCGGGATGGGCTCAGGCACCCTAACATTGTGGAGATGGAAGGCTTCTTCGAGGACGATATC
AATTATTACATTGAAATGACTCCTCACGGGCTTCCGGGAATGGATCTGTTCGATTATATCGAGCTCAAGGCCAAC
ATGGACGAGCTGGAGTGCCAGAACATCTTCCGACAGGTTGCGAGCGCCATTAATCATCTCCACACCAAAGCCCTG
GTGGTACATCGTGACATCAAGGATGAGAATGTGATTCTCGATGGAGAGGGACGGATCAAGTTGATCGACTTTGGG
AGTGCGGCGTATATCAAAAACGGGCCATTTGATGTCTTTGTGGGAACCATTGATTATGCCGCGCCCGAGGCCTTA
CAGGGCCGGTCGTATCGAGGCAAGGAACAGGACATCTGGGCTCTAGGGATTCTCCTTTACACCATCGTCTACAAA
GAGAACCCGTTCTACAACGTCGATGAGATCCTTGACCACCCCCTCCGAATTCCTTTCCTTCCTTTCTCAGAAGAC
TGCATTGACCTCATCCGCACGATGCTCGATCGTGACGTTGACAACCGACTCACCATTACCGAAGTGCTTGAACAT
CCTTGGATGGTGAATATTAAGAAATGGTTCAAGCACATGCCTAGGTATCGCATTCCCTCCGCTCTGCATTCCGCC
ATTTCTTGTTCCTCTTTGCACCTCTCTTTCTCTCCTCCTTTCGCAACTTCCCCCGCCCTCTGTATCTTCTACTCG
GCTCTTTCGGTTCTCTCGGTTTTCTGTACGGTGTCTTTGCCGAAACCTGTTCCACGGTTCCTTCGCCGTGGCCCT
ACAACAAACAATAACGGTCAATACCGGTCATCCTTGAGATCGAACACTATGCCCATTTAA
Gene >Pro_DTO377G3_2|g3015.t1
ATGCATCTGACCGTGGAGATGAAGCGTCTGATCATTCCAAACCGTCACGTTTCCTGAAAGGCCCATGGAATGGAA
ACTCCGAGACGCGCCGATTGACTTGATCATAAGCTAGTGAATCACGCTGATCAAGACTTAGGCGAGCCGAGTCCT
CTTTCGTCGCCGTTAGGACCTCTCTCTGAGTCGCCCGAATCCGAGTCCGGATACAACCTTTCTTTACAGACAGAC
CAACTCAGGAGCTCGGCGGGCAGTGTTTCTTCGGGATACGAACCTCTCTCCAGGTCAGCCGATTATATTCTTTCG
ACTCCTTAACATAACGTTGACACCTTCTATACTCCAACAGATCCCCGTTATTCGACAGCGACCATGGAATTGGCC
CATCTGGACTGGATCGTATACGCCAAAATCAACCCTCGAGAGTACTGACCCTTCCAAACATGTCTTCCTCGTCGC
TATCACTAGCACCTATGACTGGCCAGCGCCCCTCTCCCTCTCCCCGTTCTCGCTCATCTTCTCGAGCTCACACCA
ATCTTTTGTCGAGCCGAAGTTTCACGGATCTAGCGGACCTACACCGGTTTCCACTGGAGTCGCTACACTCCTTTT
CCTTTGCCCAGCAGTCCGAGGAGTTTCTCCACAGCCGTCAGAACATTCTCAAAAGGTCTGTTGATTTCATGCGCG
ACCGGATGGGATGGGCCGCCACCAATGCCGCGATCGCCAGCGCACAAGCAAACGCCAGTGGGGACACGGAGATGC
AAGGTATGATGGACCTTTTGGCCCGAGCGAATATTCTCGAAACCCAGGATAACCAACTCCATGGCCGTGGACCCA
GCACAGGACCCGCAGAGATTAATAGCGACAATATCTTCGAGAAGGCCTTCGCAGACGGCAATTCCTCCCCGGTCA
GCACCCGAGAGGGTGCCCAGGATTCCATTCCTTTGGGATCACATCCTTCTGACAGCTCCCAATTGTTGAGCCCGG
TGCCCAGCGATCGTATCTCCAACCAAAGGAGGGACCTGGTCTCTGCACCTACATCCAGGCGCGTAAGCTTAAAAC
GTACATACACGGACCTATGCTCTGTCTCTATCAGGAGCAAGCTGATGGAAACTCTAGCACAACCATACACCTCTT
CCGCGGATCCTTTCGCCTCGCTCAATCCCTCGTCTGCTGGATTAGGATTTCAGATCCCCGCCCTCCACGCCCATA
GCAGCAAATGGACCCCGGCTTCCCAGGCCGTGTTTAGGACCGAAGCCAAGGAACCATGGACCATTCTGGCCGCTA
ATGATTTGTCGTGTCTCATCTTTGGTGTTCTTCAGTCCGAAGTTCGCCATCTCAGCATCCTGGAGGTTGTACAGA
AAGAACACCAGGAATGGCTCAAGGCTAAACTTCGAGATCCTAGCACTGACGTCGCTGCCCGCATGCCACTTCAGC
CCGAAAGAGCTAACATTTCCGCCGTCAATCCCAAGTACCGAGGTCTTGGGAACGGAGTGACAGCACAACTCCTCA
GCAAACCATCTTCACGAGAACAGTCCCGGAGAGCGCAGACTGATGACGGATATGGCTCCAGCACAAGAAACGCCC
GAAACAACAACCACCCGGCCAATAAGTCACGCGGTGTCTTGCTGTGCGGTGATGTGGTCCCGATTCAGAAGCGCA
ATGGGTCACGGGGATCCGCTAGCGTCTGGGTTATGGAAAAGCGTGGTGGCCTGATCTGGGTCCTGGAAGAAATAA
CAGAGAATATTGCCTTCATCGAGTGTGATGATTCATGGAAAGTCGTGAGTGCCAAAGGTGAAGTCGAAAAAATCT
GGGGCCCATCTGTCGTTCAAAAAGGCCAGTCGATCACCGACCTTTTACCTTGTTTGCCATCGGAATCTCTTGAGA
CATCCCTCGAGAAGGGATTGGCTAAAATCGTGGAGCTGAGGCACTTTGCCGCCCGCACTGCGGCTGGCGTTTGTA
TTCCCGTCGCGGTCGGCAAGGGAGAAGGAGATTACACTATGCAAGTCTCCAGCTTTCCTCATGTCGCAGGCATGA
TGGTGCTCTCGTCCTCGTCATTGAACGTGATCAGCTCCAACTCTGTGTTCTCTTCGGTTCTCTTCGGTCAAGAGA
GACCGGAAGGACTTCACATCACTCAGCTTGTACCCGATTTCGATGAGATGCTAGACGTTTTGACCGAGGAGGACA
ACGTACCACTAGTTGATGGTATTGTCATACCGGAACACAGCTTCCGGCGTGCACGGACACTTTCTATTCTCCGCG
ACGGAAAAGCAAATGCCGCCTCTGTGTTTACAGAGCCAAGTGGCTTGCTTGCCAAGCATCGGGATGGCTCGACCA
TTGTCGTGGACATTCAACTGCGCGTGGTTCAGAGTGGCACCTGCTTCTCAAAGGACAAGACAGAGAAAAGCAGCA
AAAGCAGCAAAAGCAGTGATCGCACCAGTGACTCTGATGAGAGTGATGATACCGTTGCAGTCACAGAGTTGGTCT
ATGCTTTGTGGATAACCTACTCGAGACAGCTCCACGCTGCTGGACCCGCTGCTGGCCTGTCGCCATCATCTGTCC
CAAGTTCTAAGCCTACCTCACCCACACATGACCCTGATTCAGATCGCCCTTTAGACGCCGGTGTTGCTGCCCAGA
CGGAAAACCCCAAGATTTCTGTGGAGATTGAAGCTCCGACGTCAGCACTTAGTCAACAACTCAGTGAGGCTGCCT
CTGAGCCTCTGACCACCCGTCCCCCGCAGCCCGTTCCTCCGGTCTCGGCTGCCAATGCGAAGAACGACCCTCCGG
CGAAACGAACGATCAACGACTACGTGATTCTCGAAGAGATGGGACAAGGAGCCTACGGCCAAGTCAAACTGGCCC
GTTTAAAGAAGCAGCCTAGCAAGAAGATGGTGTTGAAATTCGTCACGAAGAAGCGGATCCTGGTGGATACGTGGA
CTCGGGATCGGCGACTCGGGACTGTGCCATTGGAGATCCATGTTCTGGACTTCCTACGGCGGGATGGGCTCAGGC
ACCCTAACATTGTGGAGATGGAAGGCTTCTTCGAGGACGATATCAATTATTACATTGAAATGACTCCTCACGGGC
TTCCGGGAATGGATCTGTTCGATTATATCGAGCTCAAGGCCAACATGGACGAGCTGGAGTGCCAGAACATCTTCC
GACAGGTTGCGAGCGCCATTAATCATCTCCACACCAAAGCCCTGGTGGTACATCGTGACATCAAGGATGAGAATG
TGATTCTCGATGGAGAGGGACGGATCAAGTTGATCGACTTTGGGAGTGCGGCGTATATCAAAAACGGGCCATTTG
ATGTCTTTGTGGGAACCATTGGTAAGTTTCCTTCTCTTTGACCGGGGAGGATTCAGTGCTGACTATGTTTGTTAG
ATTATGCCGCGCCCGAGGCCTTACAGGGCCGGTCGTATCGAGGCAAGGAACAGGACATCTGGGCTCTAGGGATTC
TCCTTTACACCATCGTCTACAAAGAGAACCCGTTCTACAACGTCGATGAGATCCTTGACCACCCCCTCCGAATTC
CTTTCCTTCCTTTCTCAGAAGACTGCATTGACCTCATCCGCACGATGCTCGATCGTGACGTTGACAACCGACTCA
CCATTACCGAAGTGCTTGAACATCCTTGGATGGTGGTGACTTGAATCCCTTCTCATACGACTCTACTCTCCCTTC
TCCCTCCGCCTTTTACTTATTGACAAAAAAACACAAATAACGCGATACCCCACAAAGTTACGTTTTGATGATGGA
TGCCAAATTTTCCGGGAAACTGGGTATCATTTCGGGGCCGGTGTGGAGCGAGTGTCTGTTCTTCTAACTTCCCTA
GGACCACGTTGATGATGATGATGAACATCAACGCATGATTTGTCTTACTTCTTTTATCGGGGTTTATTTTTATCG
AGCTTTTTTCACCCCCTTTTCATGGCATTTGAATTTGCGATACCTTTTGCATATCTCTTTATGTGACCTAGAGAC
CTAAGAGGGCAGACTTACATACAACGTACGGAGTACGGCTTTGATTAGATTGCGGGGAACATTTAGCGTACGTCT
CTTTCTGGCAAATAGTCTACGATAGCCTAGGCTATGACTATCACCTCTCCACTTCATATGCAACCTTAAGGAGTT
GATACCAGCAATTTGAGCTAAGGACCTCGGGAATATGTTGCTACACTGACACTTGGTGCCTTGACTTCCAAAACA
AAACCCTCAAACGAGACAAACAGGAAACTTACCGTAAAATACGAAGTCGAACCTCGGAAGACATACATATGGCAT
GTTTGATTCCATGGGTTCCCTGCCATCGTACCACGGGTTAGTCGTCTTCCCCGCACGCGCCCCACCAGCGAAAAT
AGTCCGAAAGAGGCGAAAATGAATTTAACGGGTTGCCTCGCAGGATTCAGGAACGACTTCGCCTTCGGGGTGTCC
CTGGATCGGTGCCTCGAGTGGATTCCCGCTTGGGTGGCGTCGAATTCGGTGTATCTTCTGTTCAAGGCGTCGTCA
GCCGAGGTGTGCACTTGGTTTCACATTAGACGATCTGTGTCAAGACATTCTGTAGCGTAGAAATGAAAGTAGGAT
ATACTCTAGGATATACTCCAAAGTCACCGGGATATAGAATATTAAGAAATGGTTCAAGCACATGCCTGTATATAC
CGGTGCCTAGTACTAACAGACGAGAAGCGATAAGCAGATAACGTAGAGGGGCGAGGTACTTGCGCAGTACAACGT
CGGGCTATGTGAGAAAAGGCCAGTGCCAGGTTTAGCAGAGGTATCGCATTCCCTCCGCTCTGCATTCCGCCATTT
CTTGTTCCTCTTTGCACCTCTCTTTCTCTCCTCCTTTCGCAACTTCCCCCGCCCTCTGTATCTTCTACTCGGCTC
TTTCGGTTCTCTCGGTTTTCTGTACGGTGTCTTTGCCGAAACCTGTTCCACGGTTCCTTCGCCGTGGCCCTACAA
CAAACAATAACGGTCAATGTGATTTTTCCCCACCGACATTCTGATCACTTCCTCTCTATGTCTCTCTGACCTTCA
GATCGCTAATATCCAAAAGACCGGTCATCCTTGAGATCGAACACTATGCCCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail