Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g30.t1
Gene name
Locationscaffold_01:74296..75627
Strand-
Gene length (bp)1331
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 2.7E-04 119 171
PF00571 CBS CBS domain 2.1E-03 194 233
PF00571 CBS CBS domain 4.2E-09 267 314

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 114.39 69.58 159.20
5d_25C Five days - 25 degrees Celsius 125.11 76.04 174.17
7d_25C Seven days - 25 degrees Celsius 126.44 76.82 176.06
10d_25C Ten days - 25 degrees Celsius 144.47 88.59 200.36
7d_15C Seven days - 15 degrees Celsius 131.69 80.16 183.21
7d_30C Seven days - 30 degrees Celsius 116.05 70.49 161.60

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.765441 no
3d_25C 7d_25C 0.737058 no
3d_25C 7d_15C 0.602580 no
3d_25C 7d_30C 0.968710 no
3d_25C 10d_25C 0.321228 no
5d_25C 7d_25C 0.977206 no
5d_25C 7d_15C 0.875745 no
5d_25C 7d_30C 0.810516 no
5d_25C 10d_25C 0.590676 no
7d_25C 7d_15C 0.904661 no
7d_25C 7d_30C 0.777392 no
7d_25C 10d_25C 0.620818 no
7d_15C 7d_30C 0.650012 no
7d_15C 10d_25C 0.744218 no
7d_30C 10d_25C 0.358102 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g30.t1
MASERAIDREERQGLRAIRDFLKARNSYDVLPLSFRLIIFDTSLSVKESLNILIQNGIVSAPLWDSKASKFAGLL
TTSDYINVIQYYFQNPAALDQIDQFRLDSLREVEKALGVAPPETVSIDPERPLYDACRRMLESRARRIPLVTSDS
QTERPHVLSVITQYRILKFVAVNVPDTQQLRRPLGELLLGSYDNVATASMDTPVIDVIHILVERSISSVPIVNSE
GVVYNVFESVDVITLIKGGFYDDLSLTVGEALKKRSPGFPGIYTCSLNDGLDTIFDTIRKSRVHRLVVVDEHFKL
KGVLTLSDILHYILLEGENEEA*
Coding >Pro_DTO377G3_2|g30.t1
ATGGCCTCCGAGCGAGCGATCGATCGGGAAGAGCGACAGGGCCTTCGTGCCATTCGCGATTTCCTTAAGGCCCGA
AACTCCTACGATGTCCTGCCGCTCAGCTTCCGACTCATCATCTTCGATACGTCGCTTTCCGTCAAGGAGAGTCTG
AACATTCTGATTCAAAACGGCATCGTTTCAGCTCCGTTGTGGGACTCCAAAGCGTCCAAATTCGCAGGTCTTCTG
ACCACTTCCGACTATATCAATGTCATCCAATACTATTTCCAAAACCCCGCGGCGCTGGATCAGATCGATCAATTC
CGCCTGGACAGTTTGCGAGAGGTTGAAAAAGCGCTAGGCGTCGCGCCGCCAGAGACCGTCTCCATCGACCCCGAG
CGCCCTCTCTACGATGCCTGTCGGCGCATGTTGGAATCGCGCGCCCGCCGTATCCCCCTCGTCACCAGCGATAGC
CAGACCGAGCGGCCCCACGTTCTCAGCGTCATCACGCAATACCGTATCTTGAAATTCGTTGCCGTCAATGTCCCC
GATACGCAGCAGCTCCGTCGTCCGCTGGGCGAGCTCTTGCTTGGATCGTATGATAACGTCGCCACGGCTTCGATG
GATACCCCGGTTATTGATGTCATCCATATTTTGGTCGAGCGCAGCATATCCAGTGTACCGATCGTGAACTCGGAA
GGTGTGGTGTATAATGTATTCGAGTCGGTCGATGTCATTACTTTGATCAAGGGTGGTTTCTACGATGACTTGAGT
CTCACGGTTGGGGAAGCATTGAAGAAACGTTCGCCGGGTTTCCCGGGTATCTACACATGTTCATTGAATGATGGA
CTGGATACTATCTTTGATACTATCCGCAAATCTCGAGTGCACCGTCTCGTCGTCGTGGATGAGCACTTCAAGCTC
AAGGGCGTTTTGACTCTGAGTGATATCCTGCACTACATTCTTCTCGAGGGAGAGAATGAGGAAGCATGA
Transcript >Pro_DTO377G3_2|g30.t1
ATGGCCTCCGAGCGAGCGATCGATCGGGAAGAGCGACAGGGCCTTCGTGCCATTCGCGATTTCCTTAAGGCCCGA
AACTCCTACGATGTCCTGCCGCTCAGCTTCCGACTCATCATCTTCGATACGTCGCTTTCCGTCAAGGAGAGTCTG
AACATTCTGATTCAAAACGGCATCGTTTCAGCTCCGTTGTGGGACTCCAAAGCGTCCAAATTCGCAGGTCTTCTG
ACCACTTCCGACTATATCAATGTCATCCAATACTATTTCCAAAACCCCGCGGCGCTGGATCAGATCGATCAATTC
CGCCTGGACAGTTTGCGAGAGGTTGAAAAAGCGCTAGGCGTCGCGCCGCCAGAGACCGTCTCCATCGACCCCGAG
CGCCCTCTCTACGATGCCTGTCGGCGCATGTTGGAATCGCGCGCCCGCCGTATCCCCCTCGTCACCAGCGATAGC
CAGACCGAGCGGCCCCACGTTCTCAGCGTCATCACGCAATACCGTATCTTGAAATTCGTTGCCGTCAATGTCCCC
GATACGCAGCAGCTCCGTCGTCCGCTGGGCGAGCTCTTGCTTGGATCGTATGATAACGTCGCCACGGCTTCGATG
GATACCCCGGTTATTGATGTCATCCATATTTTGGTCGAGCGCAGCATATCCAGTGTACCGATCGTGAACTCGGAA
GGTGTGGTGTATAATGTATTCGAGTCGGTCGATGTCATTACTTTGATCAAGGGTGGTTTCTACGATGACTTGAGT
CTCACGGTTGGGGAAGCATTGAAGAAACGTTCGCCGGGTTTCCCGGGTATCTACACATGTTCATTGAATGATGGA
CTGGATACTATCTTTGATACTATCCGCAAATCTCGAGTGCACCGTCTCGTCGTCGTGGATGAGCACTTCAAGCTC
AAGGGCGTTTTGACTCTGAGTGATATCCTGCACTACATTCTTCTCGAGGGAGAGAATGAGGAAGCATGA
Gene >Pro_DTO377G3_2|g30.t1
ATGGCCTCCGAGCGAGCGATCGATCGGGAAGAGCGACAGGGCCTTGTAAGTCTTGTCCGTTTTTGCTTTTTCAAG
GGGAGACAACCCCTCTTTATACCTGACGTTGGACATGGGGATCGGACATTGTGAACGTGTTTCGGCATGGGTTCA
CCAGTCACCAGATTAGATCACCTGGGAATATCCAGATCTTGACTAACGCAGAAAATAGCGTGCCATTCGCGATTT
CCTTAAGGCCCGAAACTCCTACGATGTCCTGCCGCTCAGCTTCCGACTCATCATCTTCGATACGTCGCTTTCCGT
CAAGGAGAGTCTGAACATTCTGATTCAAAACGGTATGTTTGTCGCGATTCCCCCTCCTTCTCTACAAAATTATTG
AACTCAAGCTGATCGTGAGCCCGGAAATCGGGAGGTACAGGCATCGTTTCAGCTCCGTTGTGGGACTCCAAAGCG
TCCAAATTCGCAGGTCTTCTGACCACTTCCGACTATATCAATGTCATCCAATACTATTTCCAAAACCCCGCGGCG
CTGGATCAGATCGATCAATTCCGCCTGGACAGTTTGCGAGGTGCGTTGGATCGTGTCGCCCCATCTCTGCAGGTA
CACCCCGCAGCTAACGGGAATATACAGAGGTTGAAAAAGCGCTAGGCGTCGCGCCGCCAGAGACCGTCTCCATCG
ACCCCGAGCGCCCTCTCTACGATGCCTGTCGGCGCATGTTGGAATCGCGCGCCCGCCGTATCCCCCTCGTCACCA
GCGATAGCCAGACCGAGCGGCCCCACGTTCTCAGCGTCATCACGCAATACCGTATCTTGAAATTCGTTGCCGTCA
ATGTCCCCGATACGCAGCAGCTCCGTCGTCCGCTGGGCGAGCTCTTGCTTGGATCGTATGATAACGTCGCCACGG
CTTCGATGGATACCCCGGTTATTGATGTCATCCATATTTTGGTCGAGCGCAGCATATCCAGTGTACCGATCGTGA
ACTCGGAAGGTGTGGTGTATAATGTATTCGAGTCGGTCGATGTCATTACTTTGATCAAGGGTGGTTTCTACGATG
ACTTGAGTCTCACGGTTGGGGAAGCATTGAAGAAACGTTCGCCGGTAAATGAACCTCCGTTCCTAGTGATATCGT
TCTGATACTGATGTTCTGCGCAGGGTTTCCCGGGTATCTACACATGTTCATTGAATGATGGACTGGATACTATCT
TTGATACTATCCGCAAATCTCGAGTGCACCGTCTCGTCGTCGTGGATGAGCACTTCAAGCTCAAGGGCGTTTTGA
CTCTGAGTGATATCCTGCACTACATTCTTCTCGAGGGAGAGAATGAGGAAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail