Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2996.t1
Gene name
Locationscaffold_04:432377..434402
Strand-
Gene length (bp)2025
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 1.2E-06 59 102
PF00571 CBS CBS domain 4.9E-09 114 160
PF00571 CBS CBS domain 2.5E-06 225 269
PF00571 CBS CBS domain 3.4E-05 285 329
PF00564 PB1 PB1 domain 3.7E-09 428 525

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 588 607 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 29.75 17.05 42.46
5d_25C Five days - 25 degrees Celsius 18.30 9.39 27.22
7d_25C Seven days - 25 degrees Celsius 17.74 8.81 26.67
10d_25C Ten days - 25 degrees Celsius 13.85 6.42 21.27
7d_15C Seven days - 15 degrees Celsius 23.26 11.57 34.95
7d_30C Seven days - 30 degrees Celsius 24.24 12.99 35.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.050536 no
3d_25C 7d_25C 0.040411 yes
3d_25C 7d_15C 0.400539 no
3d_25C 7d_30C 0.473774 no
3d_25C 10d_25C 0.004840 yes
5d_25C 7d_25C 0.942050 no
5d_25C 7d_15C 0.450849 no
5d_25C 7d_30C 0.325602 no
5d_25C 10d_25C 0.381946 no
7d_25C 7d_15C 0.387835 no
7d_25C 7d_30C 0.274110 no
7d_25C 10d_25C 0.458446 no
7d_15C 7d_30C 0.919022 no
7d_15C 10d_25C 0.060388 no
7d_30C 10d_25C 0.036077 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2996.t1
MSAASSRQRQNQSKRDEAIRRKMEADLSKKRNTPAKSRSSRKAPPGTVLALKPSQALQIKPTMSIAEAAQLMAAK
REDCVLVTDDNERISGIFTAKDLAFRVVGMGLKARDVSVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMD
ENQDISGVLDITKCFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQVIQYVEALRSKMSGPTLETVLDGLP
PVTVSVRTTVKDAAALMKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTCSVVRVMTPHPDFAPSDMSI
QAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQINTMSTQDDEGPAWNKFWLSMDHESDSMVSGGHSQ
QLNTPHRSVISPDLTRSGYDNSLLPNDSASHHGDDHSAISQHYPIEPAAPTPFPFKFKAPGGRVHRVNVLTTSGI
TDLVLQVTAKLGKEVEDVGGEATVEEGRLSHTGYALSYMDNEGDTVSITTDQDMTDAIDLARRTHRDKVNLFVHD
PAQAPNTVFEPHHVKIVTPMEEQSSAEEPTSQDSPVSKALPQPQVVPLHAPEEQYIAGVPNDLLLPGAIVTLAAV
IVGVFILSRPGHR*
Coding >Pro_DTO377G3_2|g2996.t1
ATGAGCGCCGCAAGTAGCAGACAGCGACAGAACCAGTCAAAACGTGATGAGGCCATCCGCCGCAAAATGGAGGCC
GACCTCAGCAAAAAAAGGAATACTCCGGCAAAATCGAGGAGCTCCCGCAAAGCGCCTCCCGGTACGGTGCTCGCC
CTGAAGCCCAGCCAAGCCCTCCAGATCAAGCCGACCATGAGTATCGCAGAGGCCGCCCAGCTTATGGCCGCGAAG
AGAGAGGACTGTGTGTTGGTCACCGACGATAATGAGCGCATCTCGGGTATTTTCACTGCCAAGGATCTGGCGTTC
CGAGTCGTCGGAATGGGCCTGAAGGCGCGAGACGTCTCTGTCGCTGAAATCATGACCAAGAACCCGCTGTGCGCG
AGAACGGACACCAGCGCTACCGATGCCCTCGATCTTATGGTGCGAAAGGGATTCAGACATTTGCCAGTCATGGAT
GAGAATCAGGATATCTCTGGTGTTTTGGATATTACCAAGTGCTTCTACGATGCTATGGAAAAATTGGAGCGCGCA
TACAGTTCGTCTCGCAAGCTGTACGATGCGCTGGAAGGTGTGCAGACAGAGCTTGGCTCCAGTCAGCCCCAGCAA
GTTATCCAATATGTGGAGGCATTGCGATCCAAGATGTCCGGTCCGACTCTTGAGACGGTCTTGGATGGCTTGCCG
CCGGTCACTGTCTCGGTCCGCACCACCGTCAAGGACGCTGCGGCTCTGATGAAGGAAAACCACACTACTGCTCTG
CTAGTCCAGGACCAAGGCTCGATCACTGGTATATTCACTAGCAAGGATATCGTTCTTCGCGTTATTGCTCCTGGC
CTTGATCCATCTACTTGCAGTGTTGTCCGTGTCATGACTCCTCACCCCGATTTCGCCCCGTCGGATATGAGCATC
CAAGCCGCACTTCGCAAGATGCATGATGGCCACTATCTTAACCTGCCCGTGATGAACGAGGGTGGTGAAATCGTT
GGCATGGTGGATGTGTTGAAGCTTACATATGCCACTCTTGAACAGATCAACACCATGTCAACCCAAGATGACGAG
GGCCCCGCTTGGAACAAATTTTGGTTATCAATGGATCACGAGTCAGACTCCATGGTCTCTGGCGGCCACAGCCAG
CAACTGAATACCCCACACCGCTCAGTTATCAGTCCCGACCTCACTCGCTCAGGCTACGACAACAGTCTTCTCCCC
AACGACTCAGCATCGCACCACGGTGATGATCATTCCGCTATCTCTCAGCACTACCCAATAGAACCAGCCGCTCCT
ACTCCATTCCCCTTCAAGTTCAAAGCCCCTGGTGGTCGAGTGCACCGTGTGAACGTCCTTACCACCAGCGGCATT
ACCGACCTTGTGTTGCAAGTCACGGCGAAACTTGGCAAGGAAGTCGAGGATGTTGGTGGCGAGGCCACTGTTGAG
GAGGGTCGGCTGAGCCACACTGGATATGCCCTCAGCTATATGGACAACGAAGGCGATACCGTCTCCATTACCACG
GACCAGGATATGACGGATGCCATCGATCTGGCCCGCCGCACTCACCGCGACAAGGTCAATTTATTTGTCCACGAC
CCCGCCCAGGCACCTAACACTGTGTTTGAACCTCATCATGTTAAGATTGTGACTCCTATGGAAGAGCAAAGCTCT
GCTGAGGAACCTACATCACAAGACTCCCCAGTGAGCAAGGCCCTACCCCAGCCACAAGTCGTGCCCTTGCACGCG
CCAGAGGAGCAATATATTGCCGGTGTCCCCAACGACTTGCTGCTGCCCGGTGCTATTGTCACATTGGCTGCGGTT
ATTGTGGGTGTGTTCATTCTCAGCCGCCCCGGTCACCGGTAA
Transcript >Pro_DTO377G3_2|g2996.t1
ATGAGCGCCGCAAGTAGCAGACAGCGACAGAACCAGTCAAAACGTGATGAGGCCATCCGCCGCAAAATGGAGGCC
GACCTCAGCAAAAAAAGGAATACTCCGGCAAAATCGAGGAGCTCCCGCAAAGCGCCTCCCGGTACGGTGCTCGCC
CTGAAGCCCAGCCAAGCCCTCCAGATCAAGCCGACCATGAGTATCGCAGAGGCCGCCCAGCTTATGGCCGCGAAG
AGAGAGGACTGTGTGTTGGTCACCGACGATAATGAGCGCATCTCGGGTATTTTCACTGCCAAGGATCTGGCGTTC
CGAGTCGTCGGAATGGGCCTGAAGGCGCGAGACGTCTCTGTCGCTGAAATCATGACCAAGAACCCGCTGTGCGCG
AGAACGGACACCAGCGCTACCGATGCCCTCGATCTTATGGTGCGAAAGGGATTCAGACATTTGCCAGTCATGGAT
GAGAATCAGGATATCTCTGGTGTTTTGGATATTACCAAGTGCTTCTACGATGCTATGGAAAAATTGGAGCGCGCA
TACAGTTCGTCTCGCAAGCTGTACGATGCGCTGGAAGGTGTGCAGACAGAGCTTGGCTCCAGTCAGCCCCAGCAA
GTTATCCAATATGTGGAGGCATTGCGATCCAAGATGTCCGGTCCGACTCTTGAGACGGTCTTGGATGGCTTGCCG
CCGGTCACTGTCTCGGTCCGCACCACCGTCAAGGACGCTGCGGCTCTGATGAAGGAAAACCACACTACTGCTCTG
CTAGTCCAGGACCAAGGCTCGATCACTGGTATATTCACTAGCAAGGATATCGTTCTTCGCGTTATTGCTCCTGGC
CTTGATCCATCTACTTGCAGTGTTGTCCGTGTCATGACTCCTCACCCCGATTTCGCCCCGTCGGATATGAGCATC
CAAGCCGCACTTCGCAAGATGCATGATGGCCACTATCTTAACCTGCCCGTGATGAACGAGGGTGGTGAAATCGTT
GGCATGGTGGATGTGTTGAAGCTTACATATGCCACTCTTGAACAGATCAACACCATGTCAACCCAAGATGACGAG
GGCCCCGCTTGGAACAAATTTTGGTTATCAATGGATCACGAGTCAGACTCCATGGTCTCTGGCGGCCACAGCCAG
CAACTGAATACCCCACACCGCTCAGTTATCAGTCCCGACCTCACTCGCTCAGGCTACGACAACAGTCTTCTCCCC
AACGACTCAGCATCGCACCACGGTGATGATCATTCCGCTATCTCTCAGCACTACCCAATAGAACCAGCCGCTCCT
ACTCCATTCCCCTTCAAGTTCAAAGCCCCTGGTGGTCGAGTGCACCGTGTGAACGTCCTTACCACCAGCGGCATT
ACCGACCTTGTGTTGCAAGTCACGGCGAAACTTGGCAAGGAAGTCGAGGATGTTGGTGGCGAGGCCACTGTTGAG
GAGGGTCGGCTGAGCCACACTGGATATGCCCTCAGCTATATGGACAACGAAGGCGATACCGTCTCCATTACCACG
GACCAGGATATGACGGATGCCATCGATCTGGCCCGCCGCACTCACCGCGACAAGGTCAATTTATTTGTCCACGAC
CCCGCCCAGGCACCTAACACTGTGTTTGAACCTCATCATGTTAAGATTGTGACTCCTATGGAAGAGCAAAGCTCT
GCTGAGGAACCTACATCACAAGACTCCCCAGTGAGCAAGGCCCTACCCCAGCCACAAGTCGTGCCCTTGCACGCG
CCAGAGGAGCAATATATTGCCGGTGTCCCCAACGACTTGCTGCTGCCCGGTGCTATTGTCACATTGGCTGCGGTT
ATTGTGGGTGTGTTCATTCTCAGCCGCCCCGGTCACCGGTAA
Gene >Pro_DTO377G3_2|g2996.t1
ATGAGCGCCGCAAGTAGCAGACAGCGACAGAACCAGTCAAAACGTGATGAGGTACGTTATGGCAGCTAGCGGGAG
TGATCTCCTGATGGTCAATTTGAGCCTCGGCTTTTAGCTAATCTCGACACAAGGCCATCCGCCGCAAAATGGAGG
CCGACCTCAGCAAAAAAAGGAATACTCCGGCAAAATCGAGGAGCTCCCGCAAAGCGCCTCCCGGTACGGTGCTCG
CCCTGAAGCCCAGCCAAGCCCTCCAGATCAAGCCGACCATGAGTATCGCAGAGGCCGCCCAGCTTATGGCCGCGA
AGAGAGAGGACTGTGTGTTGGTCACCGACGATAATGAGCGCATCTCGGGTATTTTCACTGCCAAGGATCTGGCGT
TCCGAGTCGTCGGAATGGGCCTGAAGGCGCGAGACGTCTCTGTCGCTGAAATCATGACCAAGAACCCGCTGTGCG
CGAGAACGGACACCAGCGCTACCGATGCCCTCGATCTTATGGTGCGAAAGGGATTCAGACATTTGCCAGTCATGG
ATGAGAATCAGGATATCTCTGGTGTTTTGGATATTACCAAGTGCTTCTACGATGCTATGGAAAAATTGGAGCGCG
CATACAGTTCGTCTCGCAAGCTGTACGATGCGCTGGAAGGTGTGCAGACAGAGCTTGGCTCCAGTCAGCCCCAGC
AAGTTATCCAATATGTGGAGGCATTGCGATCCAAGATGTCCGGTCCGACTCTTGAGACGGTCTTGGATGGCTTGC
CGCCGGTCACTGTCTCGGTCCGCACCACCGTCAAGGACGCTGCGGCTCTGATGAAGGAAAACCACACTACTGCTC
TGCTAGTCCAGGACCAAGGCTCGATCACTGGTATATTCACTAGCAAGGATATCGTTCTTCGCGTTATTGCTCCTG
GCCTTGATCCATCTACTTGCAGTGTTGTCCGTGTCATGACTCCTCACCCCGATTTCGCCCCGTCGGATATGAGCA
TCCAAGCCGCACTTCGCAAGATGCATGGTCAGTCATTTCAGTCAGCGGTTCAAACCGAAGCATGCTAACTCTACA
ACAGATGGCCACTATCTTAACCTGCCCGTGATGAACGAGGGTGGTGAAATCGTTGGCATGGTGGATGTGTTGAAG
CTTACATATGCCACTCTTGAACAGGTATGTTTGAAAGTTACAGATCTGACATGCAAAAATTTTGACTAATGTATT
CAGATCAACACCATGTCAACCCAAGATGACGAGGGCCCCGCTTGGAACAAATTTTGGTTATCAATGGATCACGAG
TCAGACTCCATGGTCTCTGGCGGCCACAGCCAGCAACTGAATACCCCACACCGCTCAGTTATCAGTCCCGACCTC
ACTCGCTCAGGCTACGACAACAGTCTTCTCCCCAACGACTCAGCATCGCACCACGGTGATGATCATTCCGCTATC
TCTCAGCACTACCCAATAGAACCAGCCGCTCCTACTCCATTCCCCTTCAAGTTCAAAGCCCCTGGTGGTCGAGTG
CACCGTGTGAACGTCCTTACCACCAGCGGCATTACCGACCTTGTGTTGCAAGTCACGGCGAAACTTGGCAAGGAA
GTCGAGGATGTTGGTGGCGAGGCCACTGTTGAGGAGGGTCGGCTGAGCCACACTGGATATGCCCTCAGCTATATG
GACAACGAAGGCGATACCGTCTCCATTACCACGGACCAGGATATGACGGATGCCATCGATCTGGCCCGCCGCACT
CACCGCGACAAGGTCAATTTATTTGTCCACGACCCCGCCCAGGCACCTAACACTGTGTTTGAACCTCATCATGTT
AAGATTGTGACTCCTATGGAAGAGCAAAGCTCTGCTGAGGAACCTACATCACAAGACTCCCCAGTGAGCAAGGCC
CTACCCCAGCCACAAGTCGTGCCCTTGCACGCGCCAGAGGAGCAATATATTGCCGGTGTCCCCAACGACTTGCTG
CTGCCCGGTGCTATTGTCACATTGGCTGCGGTTATTGTGGGTGTGTTCATTCTCAGCCGCCCCGGTCACCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail