Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2995.t1
Gene name
Locationscaffold_04:428047..431693
Strand-
Gene length (bp)3646
Transcript length (bp)3288
Coding sequence length (bp)3288
Protein length (aa) 1096

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18808 Importin_rep_4 Importin repeat 3.3E-33 276 368
PF18816 Importin_rep_5 Importin repeat 3.3E-22 1010 1060
PF13513 HEAT_EZ HEAT-like repeat 2.1E-11 384 438
PF02985 HEAT HEAT repeat 1.4E-03 413 439
PF18829 Importin_rep_6 Importin repeat 6 8.4E-14 775 878

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2995.t1
MSLLPPEVHTALSQLLRGLSTPDNVVRSQAEDQLNNDWVLNRPDVLLMGLAEQLGGAEDTIMRAFAAVLFRRIAT
KTRKDPATGDSREIFSSLPNEQRIAIREKLVICLTSETVTDVRKKIGDTLAEVARQYTDNDEQWPELLGVLFQAS
QSPDSGLRETAYRVFTTTPGIIEQQHEDAVVAVFTKGFKDDNISVRISAMEAFASLFRSISRKSQPKFFGLMPDL
LNILPPLKESSESEELSSALQALIELAEICPKMFKVMFNNLVKFSISVIGDKELSDQVRQNALELMATFADYAPN
MCRKEPEFAQEMVTQCLSLMTDVGADDDDAEEWNASEDLEPEENDLNHIAGEQCMDRLANKLGGQAILQPAFSWI
PRMMSSTNWRDRHAALMAISAISEGCRDLMVGELDQVLALVVPALQDPHPRVRYAGCNALGQMSTDFAGTMQEKY
HEIVLTNIIPVLASTEPRVQSHAAAALVNFCEEAERSTLEPYLGNLLSHLLDLLRSPKRYLQEQALSTIATIADS
AEAAFDQYYTTLMPLLLNVLKEEQGKEYRLLRAKAMECATLIALAVGKEKMGQDALNLVQILGHIQQNIVDADDP
QSQYLLHCWGRMCRVLGRDFVPYLPGVMPPLLTVAAAKADIQLLDDEEQIEQVEQDDGWEIVPLKGKIIGIKTSA
LEDKNTAIELITIYAQILEENFEPYVLETMEKIAVPGLAFFFHDPVRVSAAKLIPQLLNSYKKAHGGQSPGFAEM
WNKVAEKIIEVLSAEPTVDTLAEMYQCFYESVEVVGRNSLTPQHLQAFIESAKSTLEDYQMRVKQRLEEQAELED
GDEENLDFEYAVEDDQNLLSDMNKAFHTIFKNQGNTFLPTWQQLIPFYDAFITSQDPTQRQWALCIMDDVLEFCG
EESWAYKDHIMQPLASGLRDENAANRQAAAYGVGVAAQKGGAAWSEFVAASLPSLFQVTQHAQSRTEENVFATEN
ASASIAKILHYNPSKVQAPQDVVANWIETLPITYDEEAAPYAYSFIAQLIDQHNPAVFAKADRVFGFIVQALEAA
TLQGQTATRVATSAKQLVQVTGANADQILASVDPASQERVRKFFQ*
Coding >Pro_DTO377G3_2|g2995.t1
ATGTCCCTCCTACCTCCCGAAGTCCACACCGCGCTTTCTCAGCTGCTCCGCGGCTTGAGCACGCCCGACAATGTC
GTCAGATCCCAGGCGGAAGACCAGCTTAACAATGACTGGGTTCTGAACCGACCAGATGTCCTCTTGATGGGATTG
GCGGAACAGCTTGGGGGTGCAGAGGACACAATAATGCGTGCTTTCGCCGCTGTGCTTTTCCGAAGAATCGCGACA
AAAACCCGGAAGGATCCCGCCACAGGTGACAGCAGGGAGATTTTCTCGAGCCTACCCAACGAGCAGCGAATCGCC
ATCCGCGAGAAATTGGTGATCTGTCTAACCAGTGAGACCGTCACCGATGTACGCAAGAAGATTGGAGACACACTC
GCTGAGGTGGCGAGGCAATACACCGATAATGACGAACAGTGGCCCGAACTTCTCGGTGTTCTATTCCAGGCAAGC
CAGAGCCCTGACTCGGGCCTGCGGGAAACCGCATACCGTGTGTTCACGACCACCCCCGGTATCATTGAACAGCAG
CACGAAGACGCTGTTGTGGCGGTTTTTACCAAGGGTTTCAAGGACGATAATATTTCCGTGCGAATTTCAGCTATG
GAAGCCTTCGCTTCGTTGTTCCGGTCAATCTCCAGAAAGTCCCAGCCTAAATTCTTCGGCCTCATGCCAGACCTT
CTCAACATCCTTCCTCCTCTCAAGGAGTCCTCTGAGAGCGAGGAACTGTCCTCGGCACTCCAAGCCCTGATCGAA
TTGGCTGAAATCTGCCCAAAGATGTTCAAGGTCATGTTCAACAACTTAGTTAAGTTCAGCATTAGTGTCATTGGC
GACAAGGAGCTCAGTGACCAGGTGCGCCAGAACGCACTCGAATTGATGGCCACCTTTGCCGATTACGCCCCAAAT
ATGTGCAGGAAGGAGCCGGAGTTCGCACAGGAAATGGTCACACAATGTCTGAGTCTGATGACTGATGTCGGTGCG
GATGACGACGATGCGGAGGAATGGAACGCGTCTGAAGATCTTGAGCCTGAAGAGAACGATCTCAACCACATCGCC
GGTGAGCAGTGCATGGATCGTCTCGCCAACAAATTGGGTGGACAGGCCATCCTCCAGCCCGCATTCTCTTGGATT
CCTCGCATGATGTCGTCTACCAACTGGCGCGACCGCCATGCTGCTTTGATGGCCATCTCCGCTATCTCCGAAGGT
TGTCGCGACCTGATGGTCGGTGAACTCGACCAAGTCCTAGCGCTTGTTGTTCCTGCCCTCCAAGACCCTCACCCC
CGAGTCCGGTATGCAGGCTGCAATGCTCTTGGTCAGATGAGCACCGACTTTGCCGGTACCATGCAGGAGAAGTAT
CACGAGATTGTCCTCACTAACATCATTCCCGTTCTTGCCTCTACCGAGCCGCGTGTGCAGTCCCACGCTGCCGCT
GCTCTTGTCAATTTCTGCGAGGAGGCGGAGCGCAGCACCTTGGAGCCATACCTCGGAAACCTTCTCAGCCATCTC
CTGGATCTCTTGCGCAGCCCTAAGCGTTATCTGCAGGAGCAGGCGCTGTCCACTATTGCCACTATTGCTGATTCT
GCCGAGGCCGCCTTCGACCAGTATTATACCACTTTGATGCCTCTTTTGCTCAATGTTCTCAAGGAGGAACAGGGT
AAGGAGTACCGCCTTCTTCGTGCCAAGGCCATGGAGTGTGCTACTCTGATCGCACTGGCCGTTGGTAAGGAGAAG
ATGGGTCAAGACGCCCTGAACCTTGTGCAGATTCTCGGCCACATTCAGCAAAACATTGTCGACGCCGACGACCCA
CAGTCACAGTACCTCCTTCACTGCTGGGGCCGCATGTGCCGCGTCTTAGGCCGAGACTTCGTACCTTATCTCCCC
GGTGTTATGCCGCCTCTTCTCACCGTGGCTGCTGCCAAGGCCGATATCCAGCTGCTAGATGATGAGGAACAGATC
GAACAGGTTGAGCAGGATGATGGCTGGGAGATAGTGCCACTCAAAGGCAAGATTATTGGTATCAAGACCAGTGCT
CTTGAAGACAAGAATACCGCTATCGAATTGATCACGATCTATGCCCAAATTCTCGAGGAGAACTTCGAGCCTTAC
GTCCTGGAAACCATGGAGAAGATCGCAGTCCCTGGTCTTGCCTTCTTCTTCCACGACCCCGTTCGAGTGTCCGCT
GCCAAGCTGATTCCCCAGCTCCTGAACTCTTACAAGAAGGCACACGGTGGCCAGTCGCCGGGCTTTGCCGAAATG
TGGAACAAGGTTGCCGAGAAGATCATCGAGGTTCTGAGCGCTGAGCCGACGGTTGACACGCTGGCTGAGATGTAC
CAGTGCTTCTACGAGTCAGTAGAGGTCGTTGGCAGAAACTCCCTCACCCCCCAGCACTTGCAGGCGTTCATTGAA
TCGGCGAAGTCGACCCTTGAGGACTACCAGATGCGCGTGAAGCAACGTTTGGAGGAGCAGGCTGAGCTTGAAGAT
GGTGACGAGGAAAACCTGGACTTTGAGTACGCCGTGGAGGACGATCAAAACCTATTGAGCGATATGAACAAGGCG
TTCCACACCATCTTTAAGAACCAGGGCAACACGTTCCTGCCGACCTGGCAGCAATTGATTCCATTCTACGACGCT
TTTATCACAAGCCAGGACCCGACACAACGGCAGTGGGCTCTTTGCATCATGGATGACGTGCTCGAGTTCTGTGGT
GAAGAGTCGTGGGCATACAAGGATCATATCATGCAGCCTTTGGCTTCCGGTTTGCGGGATGAGAATGCCGCTAAC
CGTCAGGCAGCGGCGTATGGAGTTGGTGTGGCCGCACAGAAGGGTGGTGCCGCCTGGAGCGAATTTGTGGCAGCC
AGCCTCCCCAGCTTGTTCCAGGTTACACAGCATGCGCAATCCCGCACAGAGGAGAATGTGTTCGCGACCGAGAAT
GCATCTGCCAGTATTGCCAAGATCCTGCACTACAACCCGTCCAAGGTTCAGGCTCCTCAGGATGTCGTGGCCAAC
TGGATCGAGACTTTGCCCATTACCTACGACGAGGAGGCTGCTCCTTATGCCTATTCCTTCATTGCACAGTTGATT
GACCAGCACAACCCGGCCGTCTTTGCCAAGGCTGACCGTGTCTTCGGTTTCATCGTTCAGGCACTCGAGGCGGCT
ACTCTGCAGGGCCAGACCGCTACCCGGGTGGCCACATCCGCCAAGCAGCTGGTGCAAGTAACCGGCGCAAATGCA
GACCAGATTCTGGCTTCTGTGGACCCGGCTAGCCAGGAAAGAGTGCGCAAGTTCTTCCAATAA
Transcript >Pro_DTO377G3_2|g2995.t1
ATGTCCCTCCTACCTCCCGAAGTCCACACCGCGCTTTCTCAGCTGCTCCGCGGCTTGAGCACGCCCGACAATGTC
GTCAGATCCCAGGCGGAAGACCAGCTTAACAATGACTGGGTTCTGAACCGACCAGATGTCCTCTTGATGGGATTG
GCGGAACAGCTTGGGGGTGCAGAGGACACAATAATGCGTGCTTTCGCCGCTGTGCTTTTCCGAAGAATCGCGACA
AAAACCCGGAAGGATCCCGCCACAGGTGACAGCAGGGAGATTTTCTCGAGCCTACCCAACGAGCAGCGAATCGCC
ATCCGCGAGAAATTGGTGATCTGTCTAACCAGTGAGACCGTCACCGATGTACGCAAGAAGATTGGAGACACACTC
GCTGAGGTGGCGAGGCAATACACCGATAATGACGAACAGTGGCCCGAACTTCTCGGTGTTCTATTCCAGGCAAGC
CAGAGCCCTGACTCGGGCCTGCGGGAAACCGCATACCGTGTGTTCACGACCACCCCCGGTATCATTGAACAGCAG
CACGAAGACGCTGTTGTGGCGGTTTTTACCAAGGGTTTCAAGGACGATAATATTTCCGTGCGAATTTCAGCTATG
GAAGCCTTCGCTTCGTTGTTCCGGTCAATCTCCAGAAAGTCCCAGCCTAAATTCTTCGGCCTCATGCCAGACCTT
CTCAACATCCTTCCTCCTCTCAAGGAGTCCTCTGAGAGCGAGGAACTGTCCTCGGCACTCCAAGCCCTGATCGAA
TTGGCTGAAATCTGCCCAAAGATGTTCAAGGTCATGTTCAACAACTTAGTTAAGTTCAGCATTAGTGTCATTGGC
GACAAGGAGCTCAGTGACCAGGTGCGCCAGAACGCACTCGAATTGATGGCCACCTTTGCCGATTACGCCCCAAAT
ATGTGCAGGAAGGAGCCGGAGTTCGCACAGGAAATGGTCACACAATGTCTGAGTCTGATGACTGATGTCGGTGCG
GATGACGACGATGCGGAGGAATGGAACGCGTCTGAAGATCTTGAGCCTGAAGAGAACGATCTCAACCACATCGCC
GGTGAGCAGTGCATGGATCGTCTCGCCAACAAATTGGGTGGACAGGCCATCCTCCAGCCCGCATTCTCTTGGATT
CCTCGCATGATGTCGTCTACCAACTGGCGCGACCGCCATGCTGCTTTGATGGCCATCTCCGCTATCTCCGAAGGT
TGTCGCGACCTGATGGTCGGTGAACTCGACCAAGTCCTAGCGCTTGTTGTTCCTGCCCTCCAAGACCCTCACCCC
CGAGTCCGGTATGCAGGCTGCAATGCTCTTGGTCAGATGAGCACCGACTTTGCCGGTACCATGCAGGAGAAGTAT
CACGAGATTGTCCTCACTAACATCATTCCCGTTCTTGCCTCTACCGAGCCGCGTGTGCAGTCCCACGCTGCCGCT
GCTCTTGTCAATTTCTGCGAGGAGGCGGAGCGCAGCACCTTGGAGCCATACCTCGGAAACCTTCTCAGCCATCTC
CTGGATCTCTTGCGCAGCCCTAAGCGTTATCTGCAGGAGCAGGCGCTGTCCACTATTGCCACTATTGCTGATTCT
GCCGAGGCCGCCTTCGACCAGTATTATACCACTTTGATGCCTCTTTTGCTCAATGTTCTCAAGGAGGAACAGGGT
AAGGAGTACCGCCTTCTTCGTGCCAAGGCCATGGAGTGTGCTACTCTGATCGCACTGGCCGTTGGTAAGGAGAAG
ATGGGTCAAGACGCCCTGAACCTTGTGCAGATTCTCGGCCACATTCAGCAAAACATTGTCGACGCCGACGACCCA
CAGTCACAGTACCTCCTTCACTGCTGGGGCCGCATGTGCCGCGTCTTAGGCCGAGACTTCGTACCTTATCTCCCC
GGTGTTATGCCGCCTCTTCTCACCGTGGCTGCTGCCAAGGCCGATATCCAGCTGCTAGATGATGAGGAACAGATC
GAACAGGTTGAGCAGGATGATGGCTGGGAGATAGTGCCACTCAAAGGCAAGATTATTGGTATCAAGACCAGTGCT
CTTGAAGACAAGAATACCGCTATCGAATTGATCACGATCTATGCCCAAATTCTCGAGGAGAACTTCGAGCCTTAC
GTCCTGGAAACCATGGAGAAGATCGCAGTCCCTGGTCTTGCCTTCTTCTTCCACGACCCCGTTCGAGTGTCCGCT
GCCAAGCTGATTCCCCAGCTCCTGAACTCTTACAAGAAGGCACACGGTGGCCAGTCGCCGGGCTTTGCCGAAATG
TGGAACAAGGTTGCCGAGAAGATCATCGAGGTTCTGAGCGCTGAGCCGACGGTTGACACGCTGGCTGAGATGTAC
CAGTGCTTCTACGAGTCAGTAGAGGTCGTTGGCAGAAACTCCCTCACCCCCCAGCACTTGCAGGCGTTCATTGAA
TCGGCGAAGTCGACCCTTGAGGACTACCAGATGCGCGTGAAGCAACGTTTGGAGGAGCAGGCTGAGCTTGAAGAT
GGTGACGAGGAAAACCTGGACTTTGAGTACGCCGTGGAGGACGATCAAAACCTATTGAGCGATATGAACAAGGCG
TTCCACACCATCTTTAAGAACCAGGGCAACACGTTCCTGCCGACCTGGCAGCAATTGATTCCATTCTACGACGCT
TTTATCACAAGCCAGGACCCGACACAACGGCAGTGGGCTCTTTGCATCATGGATGACGTGCTCGAGTTCTGTGGT
GAAGAGTCGTGGGCATACAAGGATCATATCATGCAGCCTTTGGCTTCCGGTTTGCGGGATGAGAATGCCGCTAAC
CGTCAGGCAGCGGCGTATGGAGTTGGTGTGGCCGCACAGAAGGGTGGTGCCGCCTGGAGCGAATTTGTGGCAGCC
AGCCTCCCCAGCTTGTTCCAGGTTACACAGCATGCGCAATCCCGCACAGAGGAGAATGTGTTCGCGACCGAGAAT
GCATCTGCCAGTATTGCCAAGATCCTGCACTACAACCCGTCCAAGGTTCAGGCTCCTCAGGATGTCGTGGCCAAC
TGGATCGAGACTTTGCCCATTACCTACGACGAGGAGGCTGCTCCTTATGCCTATTCCTTCATTGCACAGTTGATT
GACCAGCACAACCCGGCCGTCTTTGCCAAGGCTGACCGTGTCTTCGGTTTCATCGTTCAGGCACTCGAGGCGGCT
ACTCTGCAGGGCCAGACCGCTACCCGGGTGGCCACATCCGCCAAGCAGCTGGTGCAAGTAACCGGCGCAAATGCA
GACCAGATTCTGGCTTCTGTGGACCCGGCTAGCCAGGAAAGAGTGCGCAAGTTCTTCCAATAA
Gene >Pro_DTO377G3_2|g2995.t1
ATGTCCCTCCTACCTCCCGAAGTCCACACCGCGCTTTCTCAGCTGCTCCGCGGCTTGAGCACGCCCGACAATGTC
GTCAGATCCCAGGCGGAAGACCAGCTTAACAATGACTGGGTTCTGAACCGACCAGATGTCCTCTTGATGGGATTG
GCGGAACAGCTTGGGGGTGCAGAGGACACAATAGTAAGTTACACCGGACTCCAGGGGTGTGGCTGCTTCGAAGGA
GTGGTGTTGCAAACGATCGACGACCAGGCCAGCAGCCGAACTTCAATGTGATTTGGGATCAATAACTGATGGGAG
ACCTTTAATTACAGATGCGTGCTTTCGCCGCTGTGCTTTTCCGAAGAATCGCGACAAAAACCCGGAAGGATCCCG
CCACAGGTGACAGCAGGGAGATTTTCTCGAGCCTACCCAACGAGCAGCGAATCGCCATCCGCGAGAAATTGGTGA
TCTGTCTAACCAGTGAGACCGTCACCGATGTACGCAAGAAGATTGGAGACACACTCGCTGAGGTGGCGAGGCAAT
ACACCGATAATGGTATGCGATTCGAACAACCCTTGACAAAATGAGGACTCTTAGTTCTGACGATTTCACCTGTGA
TTGTAGACGAACAGTGGCCCGAACTTCTCGGTGTTCTATTCCAGGCAAGCCAGAGCCCTGACTCGGGCCTGCGGG
AAACCGCATACCGTGTGTTCACGACCACCCCCGGTATCATTGAACAGCAGCACGAAGACGCTGTTGTGGCGGTTT
TTACCAAGGGTTTCAAGGACGATAATATTTCCGTATGTCGACATCTGGATATGCCCTTCGAACTCAATTTTGACC
ATTTCATCAGGTGCGAATTTCAGCTATGGAAGCCTTCGCTTCGTTGTTCCGGTCAATCTCCAGAAAGTCCCAGCC
TAAATTCTTCGGCCTCATGCCAGACCTTCTCAACATCCTTCCTCCTCTCAAGGAGTCCTCTGAGAGCGAGGAACT
GTCCTCGGCACTCCAAGCCCTGATCGAATTGGCTGAAATCTGCCCAAAGATGTTCAAGGTCATGTTCAACAACTT
AGTTAAGTTCAGCATTAGTGTCATTGGCGACAAGGAGCTCAGTGACCAGGTGCGCCAGAACGCACTCGAATTGAT
GGCCACCTTTGCCGATTACGCCCCAAATATGTGCAGGAAGGAGCCGGAGTTCGCACAGGAAATGGTCACACAATG
TCTGAGTCTGATGACTGATGTCGGTGCGGATGACGACGATGCGGAGGAATGGAACGCGTCTGAAGATGTAAGTGT
TGGCATTTCTGTCGTTATAATTGACATGCCATTGACCAGTAACAGCTTGAGCCTGAAGAGAACGATCTCAACCAC
ATCGCCGGTGAGCAGTGCATGGATCGTCTCGCCAACAAATTGGGTGGACAGGCCATCCTCCAGCCCGCATTCTCT
TGGATTCCTCGCATGATGTCGTCTACCAACTGGCGCGACCGCCATGCTGCTTTGATGGCCATCTCCGCTATCTCC
GAAGGTTGTCGCGACCTGATGGTCGGTGAACTCGACCAAGTCCTAGCGCTTGTTGTTCCTGCCCTCCAAGACCCT
CACCCCCGAGTCCGGTATGCAGGCTGCAATGCTCTTGGTCAGATGAGCACCGACTTTGCCGGTACCATGCAGGAG
AAGTATCACGAGATTGTCCTCACTAACATCATTCCCGTTCTTGCCTCTACCGAGCCGCGTGTGCAGTCCCACGCT
GCCGCTGCTCTTGTCAATTTCTGCGAGGAGGCGGAGCGCAGCACCTTGGAGCCATACCTCGGAAACCTTCTCAGC
CATCTCCTGGATCTCTTGCGCAGCCCTAAGCGTTATCTGCAGGAGCAGGCGCTGTCCACTATTGCCACTATTGCT
GATTCTGCCGAGGCCGCCTTCGACCAGTATTATACCACTTTGATGCCTCTTTTGCTCAATGTTCTCAAGGAGGAA
CAGGGTAAGGAGTACCGCCTTCTTCGTGCCAAGGCCATGGAGTGTGCTACTCTGATCGCACTGGCCGTTGGTAAG
GAGAAGATGGGTCAAGACGCCCTGAACCTTGTGCAGATTCTCGGCCACATTCAGCAAAACATTGTCGACGCCGAC
GACCCACAGTCACAGTACCTCCTTCACTGCTGGGGCCGCATGTGCCGCGTCTTAGGCCGAGACTTCGTACCTTAT
CTCCCCGGTGTTATGCCGCCTCTTCTCACCGTGGCTGCTGCCAAGGCCGATATCCAGCTGCTAGATGATGAGGAA
CAGATCGAACAGGTTGAGCAGGATGATGGCTGGGAGATAGTGCCACTCAAAGGCAAGATTATTGGTATCAAGACC
AGTGCTCTTGAAGACAAGAATACCGCTATCGAATTGATCACGATCTATGCCCAAATTCTCGAGGAGAACTTCGAG
CCTTACGTCCTGGAAACCATGGAGAAGATCGCAGTCCCTGGTCTTGCCTTCTTCTTCCACGACCCCGTTCGAGTG
TCCGCTGCCAAGCTGATTCCCCAGCTCCTGAACTCTTACAAGAAGGCACACGGTGGCCAGTCGCCGGGCTTTGCC
GAAATGTGGAACAAGGTTGCCGAGAAGATCATCGAGGTTCTGAGCGCTGAGCCGACGGTTGACACGCTGGCTGAG
ATGTACCAGTGCTTCTACGAGTCAGTAGAGGTCGTTGGCAGAAACTCCCTCACCCCCCAGCACTTGCAGGCGTTC
ATTGAATCGGCGAAGTCGACCCTTGAGGACTACCAGATGCGCGTGAAGCAACGTTTGGAGGAGCAGGCTGAGCTT
GAAGATGGTGACGAGGAAAACCTGGACTTTGAGTACGCCGTGGAGGACGATCAAAACCTATTGAGCGATATGAAC
AAGGCGTTCCACACCATCTTTAAGAACCAGGGCAACACGTTCCTGCCGACCTGGCAGCAATTGATTCCATTCTAC
GACGCTTTTATCACAAGCCAGGACCCGACACAACGGCAGTGGGCTCTTTGCATCATGGATGACGTGCTCGAGTTC
TGTGGTGAAGAGTCGTGGGCATACAAGGATCATATCATGCAGCCTTTGGCTTCCGGTTTGCGGGATGAGAATGCC
GCTAACCGTCAGGCAGCGGCGTATGGAGTTGGTGTGGCCGCACAGAAGGGTGGTGCCGCCTGGAGCGAATTTGTG
GCAGCCAGCCTCCCCAGCTTGTTCCAGGTTACACAGCATGCGCAATCCCGCACAGAGGAGAATGTGTTCGCGACC
GAGAATGCATCTGCCAGTATTGCCAAGATCCTGCACTACAACCCGTCCAAGGTTCAGGCTCCTCAGGATGTCGTG
GCCAACTGGATCGAGACTTTGCCCATTACCTACGACGAGGAGGCTGCTCCTTATGCCTATTCCTTCATTGCACAG
TTGATTGACCAGTAAGTATTCTTGATGAAGACCCTCATACTCATGCTAATATCTTACTACCAGGCACAACCCGGC
CGTCTTTGCCAAGGCTGACCGTGTCTTCGGTTTCATCGTTCAGGCACTCGAGGCGGCTACTCTGCAGGGCCAGAC
CGCTACCCGGGTGGCCACATCCGCCAAGCAGCTGGTGCAAGTAACCGGCGCAAATGCAGACCAGATTCTGGCTTC
TGTGGACCCGGCTAGCCAGGAAAGAGTGCGCAAGTTCTTCCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail