Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2990.t1
Gene name
Locationscaffold_04:418829..420083
Strand-
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16035 Chalcone_2 Chalcone isomerase like 4.7E-81 175 398

GO

GO Term Description Terminal node
GO:0016872 intramolecular lyase activity Yes
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 66 83 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2990.t1
MASTLRQNPWRTYQCLTRQQIRTTRLSSRHLSTTPLRSNATNNPLRSRASAAADLQHASQAQRKMVLSAAGMIVC
AVGLYGVIKLDLFGLNELDTSKDDKTISTPPKNGAMRMDGPVGFTSGGPSLITIQGQDRLEQVPTGTSTIPHFPS
TIRLPTSEATEGKQEGDDLAPSQGEEYQLLGLGVRTVSFLSIEVYVVGLYVAKSDITELQRRLLHTAIHPLTTDS
DAAISGVGTTAATSLVSPERQQLKELLLDADRGDAAWSAIIKENGIRTAFRIVPTRNTDFMHLRDGWVRGITARA
KAKKTAGPSEFQDESFGTSMNDFKAVFGAGKGKSVPKGQTLVLMRDAHGALDALFQPGTDKPVKWMGRVADERIS
RLVWLNYLAGKTVSSEGARTSIVDGLMSIVERPLGTVVQKVI*
Coding >Pro_DTO377G3_2|g2990.t1
ATGGCCTCCACCCTCCGTCAGAACCCATGGCGGACTTACCAATGCCTCACTCGGCAACAAATCCGCACAACACGC
CTCTCCTCTCGCCATCTCTCCACCACTCCCCTCCGCTCCAATGCCACCAATAACCCCCTCCGCTCCCGAGCATCC
GCAGCGGCGGATCTCCAGCATGCCTCCCAAGCTCAGCGAAAGATGGTCCTCTCCGCAGCCGGCATGATTGTCTGT
GCAGTCGGTCTCTACGGTGTGATCAAGCTAGACCTCTTCGGCCTCAACGAACTAGATACCAGCAAAGATGACAAG
ACCATCTCCACACCTCCGAAGAATGGCGCAATGCGCATGGACGGACCAGTCGGCTTCACCAGCGGTGGCCCATCA
TTAATAACGATCCAAGGCCAAGACAGACTCGAGCAAGTGCCAACAGGAACAAGCACCATCCCTCACTTCCCAAGC
ACAATCCGACTCCCCACATCCGAAGCAACAGAAGGCAAGCAAGAAGGCGACGATCTAGCGCCGTCCCAAGGCGAA
GAATACCAATTACTTGGCCTTGGTGTCCGCACCGTCTCCTTCCTCTCAATTGAAGTTTACGTGGTCGGCCTGTAC
GTCGCGAAATCCGACATAACCGAGCTGCAACGCCGCCTCCTGCACACAGCAATCCACCCGCTCACTACCGATTCT
GACGCGGCCATTTCCGGCGTTGGCACTACCGCCGCTACCTCCCTCGTCTCGCCAGAGCGCCAGCAGCTCAAGGAG
CTTCTCCTTGACGCGGACCGCGGCGACGCCGCCTGGTCTGCTATCATCAAGGAAAACGGCATCCGCACTGCATTC
CGTATCGTTCCCACTCGTAACACAGACTTTATGCATCTGCGCGACGGATGGGTGCGTGGTATCACTGCGCGCGCG
AAGGCGAAGAAGACCGCGGGGCCGAGCGAGTTCCAGGATGAGAGCTTCGGAACTTCAATGAATGATTTCAAGGCT
GTTTTCGGCGCAGGGAAGGGAAAGTCGGTGCCGAAGGGACAGACGCTGGTTTTGATGCGCGATGCGCATGGCGCT
TTGGACGCGCTCTTCCAGCCTGGGACTGATAAGCCAGTTAAGTGGATGGGGCGTGTCGCTGATGAGCGGATTAGT
CGGCTTGTTTGGTTGAATTATTTGGCTGGCAAGACTGTTTCAAGTGAAGGGGCCCGGACGAGTATTGTCGACGGG
TTGATGTCGATTGTTGAGAGGCCACTTGGAACCGTCGTACAGAAGGTTATCTGA
Transcript >Pro_DTO377G3_2|g2990.t1
ATGGCCTCCACCCTCCGTCAGAACCCATGGCGGACTTACCAATGCCTCACTCGGCAACAAATCCGCACAACACGC
CTCTCCTCTCGCCATCTCTCCACCACTCCCCTCCGCTCCAATGCCACCAATAACCCCCTCCGCTCCCGAGCATCC
GCAGCGGCGGATCTCCAGCATGCCTCCCAAGCTCAGCGAAAGATGGTCCTCTCCGCAGCCGGCATGATTGTCTGT
GCAGTCGGTCTCTACGGTGTGATCAAGCTAGACCTCTTCGGCCTCAACGAACTAGATACCAGCAAAGATGACAAG
ACCATCTCCACACCTCCGAAGAATGGCGCAATGCGCATGGACGGACCAGTCGGCTTCACCAGCGGTGGCCCATCA
TTAATAACGATCCAAGGCCAAGACAGACTCGAGCAAGTGCCAACAGGAACAAGCACCATCCCTCACTTCCCAAGC
ACAATCCGACTCCCCACATCCGAAGCAACAGAAGGCAAGCAAGAAGGCGACGATCTAGCGCCGTCCCAAGGCGAA
GAATACCAATTACTTGGCCTTGGTGTCCGCACCGTCTCCTTCCTCTCAATTGAAGTTTACGTGGTCGGCCTGTAC
GTCGCGAAATCCGACATAACCGAGCTGCAACGCCGCCTCCTGCACACAGCAATCCACCCGCTCACTACCGATTCT
GACGCGGCCATTTCCGGCGTTGGCACTACCGCCGCTACCTCCCTCGTCTCGCCAGAGCGCCAGCAGCTCAAGGAG
CTTCTCCTTGACGCGGACCGCGGCGACGCCGCCTGGTCTGCTATCATCAAGGAAAACGGCATCCGCACTGCATTC
CGTATCGTTCCCACTCGTAACACAGACTTTATGCATCTGCGCGACGGATGGGTGCGTGGTATCACTGCGCGCGCG
AAGGCGAAGAAGACCGCGGGGCCGAGCGAGTTCCAGGATGAGAGCTTCGGAACTTCAATGAATGATTTCAAGGCT
GTTTTCGGCGCAGGGAAGGGAAAGTCGGTGCCGAAGGGACAGACGCTGGTTTTGATGCGCGATGCGCATGGCGCT
TTGGACGCGCTCTTCCAGCCTGGGACTGATAAGCCAGTTAAGTGGATGGGGCGTGTCGCTGATGAGCGGATTAGT
CGGCTTGTTTGGTTGAATTATTTGGCTGGCAAGACTGTTTCAAGTGAAGGGGCCCGGACGAGTATTGTCGACGGG
TTGATGTCGATTGTTGAGAGGCCACTTGGAACCGTCGTACAGAAGGTTATCTGA
Gene >Pro_DTO377G3_2|g2990.t1
ATGGCCTCCACCCTCCGTCAGAACCCATGGCGGACTTACCAATGCCTCACTCGGCAACAAATCCGCACAACACGC
CTCTCCTCTCGCCATCTCTCCACCACTCCCCTCCGCTCCAATGCCACCAATAACCCCCTCCGCTCCCGAGCATCC
GCAGCGGCGGATCTCCAGCATGCCTCCCAAGCTCAGCGAAAGATGGTCCTCTCCGCAGCCGGCATGATTGTCTGT
GCAGTCGGTCTCTACGGTGTGATCAAGCTAGACCTCTTCGGCCTCAACGAACTAGATACCAGCAAAGATGACAAG
ACCATCTCCACACCTCCGAAGAATGGCGCAATGCGCATGGACGGACCAGTCGGCTTCACCAGCGGTGGCCCATCA
TTAATAACGATCCAAGGCCAAGACAGACTCGAGCAAGTGCCAACAGGAACAAGCACCATCCCTCACTTCCCAAGC
ACAATCCGACTCCCCACATCCGAAGCAACAGAAGGCAAGCAAGAAGGCGACGATCTAGCGCCGTCCCAAGGCGAA
GAATACCAATTACTTGGCCTTGGTGTCCGCACCGTCTCCTTCCTCTCAATTGAAGTTTACGTGGTCGGCCTGTAC
GTCGCGAAATCCGACATAACCGAGCTGCAACGCCGCCTCCTGCACACAGCAATCCACCCGCTCACTACCGATTCT
GACGCGGCCATTTCCGGCGTTGGCACTACCGCCGCTACCTCCCTCGTCTCGCCAGAGCGCCAGCAGCTCAAGGAG
CTTCTCCTTGACGCGGACCGCGGCGACGCCGCCTGGTCTGCTATCATCAAGGAAAACGGCATCCGCACTGCATTC
CGTATCGTTCCCACTCGTAACACAGACTTTATGCATCTGCGCGACGGATGGGTGCGTGGTATCACTGCGCGCGCG
AAGGCGAAGAAGACCGCGGGGCCGAGCGAGTTCCAGGATGAGAGCTTCGGAACTTCAATGAATGATTTCAAGGCT
GTTTTCGGCGCAGGGAAGGGAAAGTCGGTGCCGAAGGGACAGACGCTGGTTTTGATGCGCGATGCGCATGGCGCT
TTGGACGCGCTCTTCCAGCCTGGGACTGATAAGCCAGTTAAGTGGATGGGGCGTGTCGCTGATGAGCGGATTAGT
CGGCTTGTTTGGTTGAATTATTTGGCTGGCAAGACTGTTTCAAGTGAAGGGGCCCGGACGAGTATTGTCGACGGG
TTGATGTCGATTGTTGAGAGGCCACTTGGAACCGTCGTACAGAAGGTTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail