Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2989.t1
Gene name
Locationscaffold_04:418060..418485
Strand+
Gene length (bp)425
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 8.1E-21 17 79

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0016491 oxidoreductase activity No
GO:0015035 protein-disulfide reductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1950.34 1189.01 2711.66
5d_25C Five days - 25 degrees Celsius 2899.73 1732.28 4067.18
7d_25C Seven days - 25 degrees Celsius 2732.62 1614.37 3850.88
10d_25C Ten days - 25 degrees Celsius 4184.16 2431.63 5936.68
7d_15C Seven days - 15 degrees Celsius 2488.86 1479.78 3497.94
7d_30C Seven days - 30 degrees Celsius 2767.97 1651.05 3884.89

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.069248 no
3d_25C 7d_25C 0.122215 no
3d_25C 7d_15C 0.299886 no
3d_25C 7d_30C 0.112039 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.857070 no
5d_25C 7d_15C 0.572701 no
5d_25C 7d_30C 0.893756 no
5d_25C 10d_25C 0.109486 no
7d_25C 7d_15C 0.754126 no
7d_25C 7d_30C 0.972210 no
7d_25C 10d_25C 0.052003 no
7d_15C 7d_30C 0.723352 no
7d_15C 10d_25C 0.017485 yes
7d_30C 10d_25C 0.062974 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2989.t1
MSAAKTRAQSLINDNAVVVFSKSYCPYCDSSKKLLDSLNAKYTTLELDQDEEGAAIQSALAEISNQRTVPNIFIN
KKHIGGNSDLQGKKDLKELLKAAGAI*
Coding >Pro_DTO377G3_2|g2989.t1
ATGTCCGCCGCAAAGACTCGCGCTCAGTCCCTCATTAACGACAACGCTGTCGTTGTTTTCTCCAAGTCATACTGC
CCTTACTGCGACTCTTCCAAGAAGTTGCTCGACAGCTTGAACGCCAAGTACACTACCCTCGAGCTGGATCAGGAT
GAGGAAGGAGCTGCTATCCAGAGCGCTCTTGCCGAGATCTCAAACCAGCGCACTGTGCCCAACATCTTCATCAAC
AAGAAGCACATCGGCGGCAACTCCGACCTCCAGGGTAAGAAGGACCTGAAGGAGCTCCTTAAGGCCGCTGGTGCG
ATCTAA
Transcript >Pro_DTO377G3_2|g2989.t1
ATGTCCGCCGCAAAGACTCGCGCTCAGTCCCTCATTAACGACAACGCTGTCGTTGTTTTCTCCAAGTCATACTGC
CCTTACTGCGACTCTTCCAAGAAGTTGCTCGACAGCTTGAACGCCAAGTACACTACCCTCGAGCTGGATCAGGAT
GAGGAAGGAGCTGCTATCCAGAGCGCTCTTGCCGAGATCTCAAACCAGCGCACTGTGCCCAACATCTTCATCAAC
AAGAAGCACATCGGCGGCAACTCCGACCTCCAGGGTAAGAAGGACCTGAAGGAGCTCCTTAAGGCCGCTGGTGCG
ATCTAA
Gene >Pro_DTO377G3_2|g2989.t1
ATGTCCGCCGCAAAGACTCGCGCTCAGTCCCTCATTAACGACAACGCTGTCGTTGTTTTCTCCAAGTCATACTGC
CCTTACTGCGACTCTTCCAAGAAGTTGCTCGACAGCTTGAACGCCAAGTACACTACCCTCGAGCTGGATCAGGAT
GGTAGGTCTTTTGCTTTTGCTCGCGTGCGAGAAGAGGAGTTTTAGCACCGAGCTAGCTATATTTTTGATACGTTT
TTTGGTCTCTCTTTTGAATGAATCGCTAATATGAGTTTATTACAGAGGAAGGAGCTGCTATCCAGAGCGCTCTTG
CCGAGATCTCAAACCAGCGCACTGTGCCCAACATCTTCATCAACAAGAAGCACATCGGCGGCAACTCCGACCTCC
AGGGTAAGAAGGACCTGAAGGAGCTCCTTAAGGCCGCTGGTGCGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail