Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2987.t1
Gene name
Locationscaffold_04:413178..414366
Strand+
Gene length (bp)1188
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02179 BAG BAG domain 6.1E-14 310 388

GO

GO Term Description Terminal node
GO:0051087 chaperone binding Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 67 84 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2987.t1
MTLLPPILAQSTLGEKCAVYIDQVTDTLPVHLHSLRLQLDPVLIYLSNTPLGPLAKKLPFAPDDQPIALLAAVVI
CIFTIVMSWRNPLKMLRRSPSYAPASSNPQVSDEDFSYITPSDMAGSPGDEADPDVISLRHRGTIYPLRFRAYAI
VDGLLTIGDIRKAAAECTGAEHPNCVRLLYKGKLLKNDAQTCKAEGLKQHSEVLCVVSDAVSQSDVSDDNGQNIP
VSASAPAPPPLPRPTSAGGASSPPTSAGGKSKNSRKKKRNGKKSPVGAEAPGPSRSPRPTSSGHSGAPAASPNIK
LLRTPLEQVNALAEWFEQEMKPLCDEYIAYPPSDKKKRNFENKKLSETILTQIQLKADGIEPNGDERARSARRAL
IKDTQAVLAELDKLVQPGDL*
Coding >Pro_DTO377G3_2|g2987.t1
ATGACTTTACTGCCCCCAATCCTCGCTCAGTCCACCTTGGGCGAGAAGTGCGCAGTATACATAGACCAGGTCACC
GATACCCTCCCCGTTCATCTACATTCCCTCCGCCTTCAACTGGACCCCGTTCTCATCTACCTGTCCAACACGCCA
CTCGGCCCTCTTGCGAAAAAGCTGCCATTTGCCCCAGACGACCAGCCGATCGCTCTCCTCGCAGCTGTTGTTATT
TGCATATTCACCATCGTGATGAGTTGGCGCAACCCCTTAAAAATGCTCCGCCGCTCGCCGAGCTACGCTCCCGCA
TCATCCAACCCGCAGGTTAGCGATGAGGATTTCAGCTACATCACACCTTCAGATATGGCGGGCTCGCCAGGAGAT
GAAGCCGACCCGGATGTTATTTCACTCCGTCACCGCGGCACTATCTACCCATTGCGCTTCCGCGCATACGCCATT
GTCGACGGTCTCTTGACTATCGGAGACATACGAAAGGCGGCTGCTGAGTGCACAGGAGCCGAACACCCGAACTGT
GTGAGGCTGCTGTACAAGGGAAAGCTACTCAAGAACGACGCGCAGACATGCAAAGCCGAGGGGCTCAAGCAGCAC
TCCGAGGTGCTATGTGTGGTGTCTGACGCAGTATCCCAGAGCGATGTCTCCGATGATAACGGACAAAACATCCCT
GTATCTGCATCAGCGCCAGCACCCCCGCCGCTACCCCGCCCCACTAGTGCAGGGGGCGCCTCGTCCCCTCCCACC
TCCGCGGGTGGAAAGAGCAAGAACTCGAGAAAGAAGAAACGCAATGGCAAGAAGTCGCCCGTCGGTGCAGAAGCC
CCCGGTCCCTCTCGGTCGCCACGGCCTACATCGTCAGGCCACTCAGGTGCCCCTGCCGCGTCGCCTAACATCAAG
TTGCTGCGTACTCCGCTGGAACAGGTCAATGCTCTGGCGGAATGGTTCGAGCAGGAGATGAAGCCGCTCTGCGAT
GAATACATTGCGTATCCGCCTAGTGACAAGAAGAAACGAAACTTTGAGAATAAGAAACTGAGCGAGACGATCCTC
ACACAAATCCAGTTGAAGGCGGATGGAATCGAGCCAAATGGTGACGAGAGGGCGCGCAGTGCACGCCGGGCCCTC
ATCAAGGATACGCAGGCGGTTCTCGCCGAGCTGGACAAACTTGTACAGCCGGGAGATTTGTAA
Transcript >Pro_DTO377G3_2|g2987.t1
ATGACTTTACTGCCCCCAATCCTCGCTCAGTCCACCTTGGGCGAGAAGTGCGCAGTATACATAGACCAGGTCACC
GATACCCTCCCCGTTCATCTACATTCCCTCCGCCTTCAACTGGACCCCGTTCTCATCTACCTGTCCAACACGCCA
CTCGGCCCTCTTGCGAAAAAGCTGCCATTTGCCCCAGACGACCAGCCGATCGCTCTCCTCGCAGCTGTTGTTATT
TGCATATTCACCATCGTGATGAGTTGGCGCAACCCCTTAAAAATGCTCCGCCGCTCGCCGAGCTACGCTCCCGCA
TCATCCAACCCGCAGGTTAGCGATGAGGATTTCAGCTACATCACACCTTCAGATATGGCGGGCTCGCCAGGAGAT
GAAGCCGACCCGGATGTTATTTCACTCCGTCACCGCGGCACTATCTACCCATTGCGCTTCCGCGCATACGCCATT
GTCGACGGTCTCTTGACTATCGGAGACATACGAAAGGCGGCTGCTGAGTGCACAGGAGCCGAACACCCGAACTGT
GTGAGGCTGCTGTACAAGGGAAAGCTACTCAAGAACGACGCGCAGACATGCAAAGCCGAGGGGCTCAAGCAGCAC
TCCGAGGTGCTATGTGTGGTGTCTGACGCAGTATCCCAGAGCGATGTCTCCGATGATAACGGACAAAACATCCCT
GTATCTGCATCAGCGCCAGCACCCCCGCCGCTACCCCGCCCCACTAGTGCAGGGGGCGCCTCGTCCCCTCCCACC
TCCGCGGGTGGAAAGAGCAAGAACTCGAGAAAGAAGAAACGCAATGGCAAGAAGTCGCCCGTCGGTGCAGAAGCC
CCCGGTCCCTCTCGGTCGCCACGGCCTACATCGTCAGGCCACTCAGGTGCCCCTGCCGCGTCGCCTAACATCAAG
TTGCTGCGTACTCCGCTGGAACAGGTCAATGCTCTGGCGGAATGGTTCGAGCAGGAGATGAAGCCGCTCTGCGAT
GAATACATTGCGTATCCGCCTAGTGACAAGAAGAAACGAAACTTTGAGAATAAGAAACTGAGCGAGACGATCCTC
ACACAAATCCAGTTGAAGGCGGATGGAATCGAGCCAAATGGTGACGAGAGGGCGCGCAGTGCACGCCGGGCCCTC
ATCAAGGATACGCAGGCGGTTCTCGCCGAGCTGGACAAACTTGTACAGCCGGGAGATTTGTAA
Gene >Pro_DTO377G3_2|g2987.t1
ATGACTTTACTGCCCCCAATCCTCGCTCAGTCCACCTTGGGCGAGAAGTGCGCAGTATACATAGACCAGGTCACC
GATACCCTCCCCGTTCATCTACATTCCCTCCGCCTTCAACTGGACCCCGTTCTCATCTACCTGTCCAACACGCCA
CTCGGCCCTCTTGCGAAAAAGCTGCCATTTGCCCCAGACGACCAGCCGATCGCTCTCCTCGCAGCTGTTGTTATT
TGCATATTCACCATCGTGATGAGTTGGCGCAACCCCTTAAAAATGCTCCGCCGCTCGCCGAGCTACGCTCCCGCA
TCATCCAACCCGCAGGTTAGCGATGAGGATTTCAGCTACATCACACCTTCAGATATGGCGGGCTCGCCAGGAGAT
GAAGCCGACCCGGATGTTATTTCACTCCGTCACCGCGGCACTATCTACCCATTGCGCTTCCGCGCATACGCCATT
GTCGACGGTCTCTTGACTATCGGAGACATACGAAAGGCGGCTGCTGAGTGCACAGGAGCCGAACACCCGAACTGT
GTGAGGCTGCTGTACAAGGGAAAGCTACTCAAGAACGACGCGCAGACATGCAAAGCCGAGGGGCTCAAGCAGCAC
TCCGAGGTGCTATGTGTGGTGTCTGACGCAGTATCCCAGAGCGATGTCTCCGATGATAACGGACAAAACATCCCT
GTATCTGCATCAGCGCCAGCACCCCCGCCGCTACCCCGCCCCACTAGTGCAGGGGGCGCCTCGTCCCCTCCCACC
TCCGCGGGTGGAAAGAGCAAGAACTCGAGAAAGAAGAAACGCAATGGCAAGAAGTCGCCCGTCGGTGCAGAAGCC
CCCGGTCCCTCTCGGTCGCCACGGCCTACATCGTCAGGCCACTCAGGTGCCCCTGCCGCGTCGCCTAACATCAAG
TTGCTGCGTACTCCGCTGGAACAGGTCAATGCTCTGGCGGAATGGTTCGAGCAGGAGATGAAGCCGCTCTGCGAT
GAATACATTGCGTATCCGCCTAGTGACAAGAAGAAACGAAACTTTGAGAATAAGAAACTGAGCGAGACGATCCTC
ACACAAATCCAGTTGAAGGCGGATGGAATCGAGCCAAATGGTGACGAGAGGGCGCGCAGTGCACGCCGGGCCCTC
ATCAAGGATACGCAGGCGGTTCTCGCCGAGCTGGACAAACTTGTACAGCCGGGAGATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail