Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2985.t1
Gene name
Locationscaffold_04:401449..403551
Strand+
Gene length (bp)2102
Transcript length (bp)2043
Coding sequence length (bp)2043
Protein length (aa) 681

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 3.1E-133 14 516

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 36 21
2 43 65 22
3 91 113 22
4 134 153 19
5 163 185 22
6 358 380 22
7 404 426 22
8 447 469 22
9 498 517 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 94.02 57.39 130.65
5d_25C Five days - 25 degrees Celsius 54.18 32.68 75.68
7d_25C Seven days - 25 degrees Celsius 59.75 35.64 83.87
10d_25C Ten days - 25 degrees Celsius 43.41 26.32 60.50
7d_15C Seven days - 15 degrees Celsius 61.79 37.02 86.57
7d_30C Seven days - 30 degrees Celsius 43.68 26.48 60.88

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.004840 yes
3d_25C 7d_25C 0.028409 yes
3d_25C 7d_15C 0.046955 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.744303 no
5d_25C 7d_15C 0.635009 no
5d_25C 7d_30C 0.385380 no
5d_25C 10d_25C 0.360975 no
7d_25C 7d_15C 0.923520 no
7d_25C 7d_30C 0.174003 no
7d_25C 10d_25C 0.159527 no
7d_15C 7d_30C 0.111330 no
7d_15C 10d_25C 0.103838 no
7d_30C 10d_25C 0.986518 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2985.t1
MFPLSVSPISVGSNVFFAFALFLISALVLLLLRRFLTLRATPAYLIVPIFLALALPASVVLLVPIDLASSSRDGS
GPKAIWLPERMVLVCWRIAYWLIFVLTWVILPLLGEYVDSGYREPKGRLMYSLRSNAKYQMIVLGCALVGLIYVS
ISNGFEFTSIKGLVMALAYVWGLVLAIYLMGHGLVSIPRNLLRNSNVSGRLRRLQAHAPKVHDRLMDSVNELANL
NGQVSQLQRRKTGTARDFQEWIEELREGHGQSDVRAPILESPDTSATIPSVITERYLADLTRRLQRARHMKTRFV
DEWDRLVQLSADLQAIINSAASKKLEFAPAPRRSSCIPRVKFLTPYMRYQLYSNVIPSVRLALGAFFAVASVCIV
WSEMIKSLAPHLSAVSLTVVPHWKDNPVGFGGQLTASAWLLYMCSAALVGVSDVKVWGNRALVRRNTYGESACWY
AGLVARLTVPIAYNFLTFLPKEFRRTTTFYQFLGKLINLTPLGKGFDFIFPIFILLPICATMFNLYGRIKNIFGC
GLAEDDDIHDVENNPAGYGMGGWREGRDLIERELNGFGSLAVSSRGGRSTWASDRDDEGSPGSSRLRLPVAEGSQ
PAQRTVVAPTIVEGEDEEDEGFFQSFAHRVKNTFDTTSTPRWFQGEPFRLPRWMSGDNNPTEEASALFGGRDVPG
RLRLG*
Coding >Pro_DTO377G3_2|g2985.t1
ATGTTTCCCTTATCTGTGTCGCCCATCTCGGTGGGTTCGAACGTCTTTTTCGCATTTGCCCTCTTCCTCATCTCC
GCACTTGTGTTACTTCTCCTGCGACGGTTTCTCACCCTCCGGGCCACCCCCGCGTATTTAATTGTCCCTATATTC
CTAGCTCTAGCTCTGCCAGCTAGTGTTGTGCTTTTGGTCCCCATCGATTTAGCATCCAGTTCGCGGGATGGATCC
GGTCCCAAAGCAATCTGGCTACCGGAACGAATGGTTTTGGTCTGCTGGCGCATTGCCTACTGGTTAATCTTTGTT
CTCACCTGGGTTATCCTCCCATTACTCGGTGAATATGTCGACTCGGGCTACCGTGAACCGAAAGGCCGGCTTATG
TACTCTCTCCGATCGAACGCCAAATACCAGATGATTGTTCTGGGATGTGCTCTGGTAGGGTTGATCTACGTTTCA
ATCTCGAATGGCTTCGAATTCACATCCATCAAAGGTCTCGTCATGGCATTGGCATATGTGTGGGGTCTCGTCCTT
GCCATTTACCTCATGGGTCATGGGCTTGTTTCGATCCCGCGCAATCTGCTCCGAAACTCCAATGTAAGCGGTCGG
CTACGCAGACTCCAGGCCCATGCGCCCAAGGTGCACGATCGCCTGATGGACTCGGTCAATGAGTTAGCGAATCTC
AATGGCCAGGTTTCGCAACTACAACGCCGTAAGACGGGAACCGCTCGTGACTTCCAGGAATGGATTGAAGAGCTT
CGGGAAGGCCACGGCCAATCCGACGTGCGCGCCCCGATCCTCGAGTCACCCGATACATCCGCAACGATACCTTCT
GTCATCACGGAACGCTATCTGGCCGACCTTACACGGCGGCTTCAGCGTGCTCGGCATATGAAGACCCGATTTGTA
GACGAGTGGGATCGGCTAGTCCAATTATCAGCCGATCTGCAAGCCATCATTAATTCTGCAGCTTCAAAGAAGCTG
GAATTTGCACCGGCTCCACGTCGGTCATCCTGCATCCCTCGTGTGAAATTCCTCACCCCGTATATGCGGTACCAG
CTGTATTCCAACGTCATTCCCTCGGTTCGGTTGGCCTTAGGTGCATTCTTCGCAGTGGCATCAGTCTGCATTGTT
TGGTCGGAAATGATCAAGTCTTTGGCGCCCCATCTCTCTGCCGTGAGTTTGACCGTGGTGCCTCACTGGAAGGAC
AATCCAGTTGGCTTTGGTGGTCAACTCACTGCCTCTGCCTGGCTATTGTACATGTGTTCGGCGGCTCTCGTTGGT
GTCAGTGATGTCAAGGTATGGGGAAACCGCGCGCTTGTCCGTCGTAATACATATGGTGAGAGTGCCTGCTGGTAC
GCCGGTCTTGTGGCTCGGTTGACAGTACCAATTGCGTACAACTTCTTGACCTTCTTGCCAAAAGAGTTTAGGCGA
ACGACTACTTTCTACCAATTCCTTGGTAAACTCATCAACCTGACCCCCCTCGGGAAAGGCTTTGATTTCATCTTC
CCAATCTTCATTCTCCTGCCTATCTGCGCAACAATGTTCAACCTGTACGGGCGTATCAAAAACATCTTCGGGTGC
GGCCTTGCAGAGGACGATGATATCCACGATGTCGAAAACAACCCTGCCGGGTATGGCATGGGTGGCTGGCGTGAG
GGTCGCGACCTCATTGAACGGGAATTGAATGGCTTCGGTTCTCTGGCGGTATCCTCCCGTGGTGGTCGCTCAACG
TGGGCGTCGGATCGTGATGATGAAGGTTCCCCTGGGTCATCCAGACTGCGGCTCCCGGTTGCAGAGGGCTCCCAA
CCTGCCCAGAGGACAGTTGTTGCGCCTACTATTGTAGAAGGCGAGGATGAGGAAGACGAGGGCTTCTTCCAGTCC
TTTGCGCATCGTGTCAAAAACACATTTGATACTACCAGCACTCCTCGGTGGTTCCAGGGTGAGCCATTCCGACTT
CCGCGCTGGATGTCGGGTGATAACAATCCCACAGAAGAAGCTTCGGCACTATTCGGAGGTCGGGACGTGCCTGGT
CGTCTGCGCCTAGGTTGA
Transcript >Pro_DTO377G3_2|g2985.t1
ATGTTTCCCTTATCTGTGTCGCCCATCTCGGTGGGTTCGAACGTCTTTTTCGCATTTGCCCTCTTCCTCATCTCC
GCACTTGTGTTACTTCTCCTGCGACGGTTTCTCACCCTCCGGGCCACCCCCGCGTATTTAATTGTCCCTATATTC
CTAGCTCTAGCTCTGCCAGCTAGTGTTGTGCTTTTGGTCCCCATCGATTTAGCATCCAGTTCGCGGGATGGATCC
GGTCCCAAAGCAATCTGGCTACCGGAACGAATGGTTTTGGTCTGCTGGCGCATTGCCTACTGGTTAATCTTTGTT
CTCACCTGGGTTATCCTCCCATTACTCGGTGAATATGTCGACTCGGGCTACCGTGAACCGAAAGGCCGGCTTATG
TACTCTCTCCGATCGAACGCCAAATACCAGATGATTGTTCTGGGATGTGCTCTGGTAGGGTTGATCTACGTTTCA
ATCTCGAATGGCTTCGAATTCACATCCATCAAAGGTCTCGTCATGGCATTGGCATATGTGTGGGGTCTCGTCCTT
GCCATTTACCTCATGGGTCATGGGCTTGTTTCGATCCCGCGCAATCTGCTCCGAAACTCCAATGTAAGCGGTCGG
CTACGCAGACTCCAGGCCCATGCGCCCAAGGTGCACGATCGCCTGATGGACTCGGTCAATGAGTTAGCGAATCTC
AATGGCCAGGTTTCGCAACTACAACGCCGTAAGACGGGAACCGCTCGTGACTTCCAGGAATGGATTGAAGAGCTT
CGGGAAGGCCACGGCCAATCCGACGTGCGCGCCCCGATCCTCGAGTCACCCGATACATCCGCAACGATACCTTCT
GTCATCACGGAACGCTATCTGGCCGACCTTACACGGCGGCTTCAGCGTGCTCGGCATATGAAGACCCGATTTGTA
GACGAGTGGGATCGGCTAGTCCAATTATCAGCCGATCTGCAAGCCATCATTAATTCTGCAGCTTCAAAGAAGCTG
GAATTTGCACCGGCTCCACGTCGGTCATCCTGCATCCCTCGTGTGAAATTCCTCACCCCGTATATGCGGTACCAG
CTGTATTCCAACGTCATTCCCTCGGTTCGGTTGGCCTTAGGTGCATTCTTCGCAGTGGCATCAGTCTGCATTGTT
TGGTCGGAAATGATCAAGTCTTTGGCGCCCCATCTCTCTGCCGTGAGTTTGACCGTGGTGCCTCACTGGAAGGAC
AATCCAGTTGGCTTTGGTGGTCAACTCACTGCCTCTGCCTGGCTATTGTACATGTGTTCGGCGGCTCTCGTTGGT
GTCAGTGATGTCAAGGTATGGGGAAACCGCGCGCTTGTCCGTCGTAATACATATGGTGAGAGTGCCTGCTGGTAC
GCCGGTCTTGTGGCTCGGTTGACAGTACCAATTGCGTACAACTTCTTGACCTTCTTGCCAAAAGAGTTTAGGCGA
ACGACTACTTTCTACCAATTCCTTGGTAAACTCATCAACCTGACCCCCCTCGGGAAAGGCTTTGATTTCATCTTC
CCAATCTTCATTCTCCTGCCTATCTGCGCAACAATGTTCAACCTGTACGGGCGTATCAAAAACATCTTCGGGTGC
GGCCTTGCAGAGGACGATGATATCCACGATGTCGAAAACAACCCTGCCGGGTATGGCATGGGTGGCTGGCGTGAG
GGTCGCGACCTCATTGAACGGGAATTGAATGGCTTCGGTTCTCTGGCGGTATCCTCCCGTGGTGGTCGCTCAACG
TGGGCGTCGGATCGTGATGATGAAGGTTCCCCTGGGTCATCCAGACTGCGGCTCCCGGTTGCAGAGGGCTCCCAA
CCTGCCCAGAGGACAGTTGTTGCGCCTACTATTGTAGAAGGCGAGGATGAGGAAGACGAGGGCTTCTTCCAGTCC
TTTGCGCATCGTGTCAAAAACACATTTGATACTACCAGCACTCCTCGGTGGTTCCAGGGTGAGCCATTCCGACTT
CCGCGCTGGATGTCGGGTGATAACAATCCCACAGAAGAAGCTTCGGCACTATTCGGAGGTCGGGACGTGCCTGGT
CGTCTGCGCCTAGGTTGA
Gene >Pro_DTO377G3_2|g2985.t1
ATGTTTCCCTTATCTGTGTCGCCCATCTCGGTGGGTTCGAACGTCTTTTTCGCATTTGCCCTCTTCCTCATCTCC
GCACTTGTGTTACTTCTCCTGCGACGGTTTCTCACCCTCCGGGCCACCCCCGCGTATTTAATTGTCCCTATATTC
CTAGCTCTAGCTCTGCCAGCTAGTGTTGTGCTTTTGGTCCCCATCGATTTAGCATCCAGTTCGCGGGATGGATCC
GGTCCCAAAGCAATCTGGCTACCGGAACGAATGGTTTTGGTCTGCTGGCGCATTGCCTACTGGTTAATCTTTGTT
CTCACCTGGTAAGTGTACTGCGCTCTTCATAACCAATGGCTGTCACTCATTCTTATCTCTCTTCCAGGGTTATCC
TCCCATTACTCGGTGAATATGTCGACTCGGGCTACCGTGAACCGAAAGGCCGGCTTATGTACTCTCTCCGATCGA
ACGCCAAATACCAGATGATTGTTCTGGGATGTGCTCTGGTAGGGTTGATCTACGTTTCAATCTCGAATGGCTTCG
AATTCACATCCATCAAAGGTCTCGTCATGGCATTGGCATATGTGTGGGGTCTCGTCCTTGCCATTTACCTCATGG
GTCATGGGCTTGTTTCGATCCCGCGCAATCTGCTCCGAAACTCCAATGTAAGCGGTCGGCTACGCAGACTCCAGG
CCCATGCGCCCAAGGTGCACGATCGCCTGATGGACTCGGTCAATGAGTTAGCGAATCTCAATGGCCAGGTTTCGC
AACTACAACGCCGTAAGACGGGAACCGCTCGTGACTTCCAGGAATGGATTGAAGAGCTTCGGGAAGGCCACGGCC
AATCCGACGTGCGCGCCCCGATCCTCGAGTCACCCGATACATCCGCAACGATACCTTCTGTCATCACGGAACGCT
ATCTGGCCGACCTTACACGGCGGCTTCAGCGTGCTCGGCATATGAAGACCCGATTTGTAGACGAGTGGGATCGGC
TAGTCCAATTATCAGCCGATCTGCAAGCCATCATTAATTCTGCAGCTTCAAAGAAGCTGGAATTTGCACCGGCTC
CACGTCGGTCATCCTGCATCCCTCGTGTGAAATTCCTCACCCCGTATATGCGGTACCAGCTGTATTCCAACGTCA
TTCCCTCGGTTCGGTTGGCCTTAGGTGCATTCTTCGCAGTGGCATCAGTCTGCATTGTTTGGTCGGAAATGATCA
AGTCTTTGGCGCCCCATCTCTCTGCCGTGAGTTTGACCGTGGTGCCTCACTGGAAGGACAATCCAGTTGGCTTTG
GTGGTCAACTCACTGCCTCTGCCTGGCTATTGTACATGTGTTCGGCGGCTCTCGTTGGTGTCAGTGATGTCAAGG
TATGGGGAAACCGCGCGCTTGTCCGTCGTAATACATATGGTGAGAGTGCCTGCTGGTACGCCGGTCTTGTGGCTC
GGTTGACAGTACCAATTGCGTACAACTTCTTGACCTTCTTGCCAAAAGAGTTTAGGCGAACGACTACTTTCTACC
AATTCCTTGGTAAACTCATCAACCTGACCCCCCTCGGGAAAGGCTTTGATTTCATCTTCCCAATCTTCATTCTCC
TGCCTATCTGCGCAACAATGTTCAACCTGTACGGGCGTATCAAAAACATCTTCGGGTGCGGCCTTGCAGAGGACG
ATGATATCCACGATGTCGAAAACAACCCTGCCGGGTATGGCATGGGTGGCTGGCGTGAGGGTCGCGACCTCATTG
AACGGGAATTGAATGGCTTCGGTTCTCTGGCGGTATCCTCCCGTGGTGGTCGCTCAACGTGGGCGTCGGATCGTG
ATGATGAAGGTTCCCCTGGGTCATCCAGACTGCGGCTCCCGGTTGCAGAGGGCTCCCAACCTGCCCAGAGGACAG
TTGTTGCGCCTACTATTGTAGAAGGCGAGGATGAGGAAGACGAGGGCTTCTTCCAGTCCTTTGCGCATCGTGTCA
AAAACACATTTGATACTACCAGCACTCCTCGGTGGTTCCAGGGTGAGCCATTCCGACTTCCGCGCTGGATGTCGG
GTGATAACAATCCCACAGAAGAAGCTTCGGCACTATTCGGAGGTCGGGACGTGCCTGGTCGTCTGCGCCTAGGTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail