Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2985.t1
Gene name
Locationscaffold_04:401449..403551
Strand+
Gene length (bp)2102
Transcript length (bp)2043
Coding sequence length (bp)2043
Protein length (aa) 681

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 3.1E-133 14 516

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 36 21
2 43 65 22
3 91 113 22
4 134 153 19
5 163 185 22
6 358 380 22
7 404 426 22
8 447 469 22
9 498 517 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2985.t1
MFPLSVSPISVGSNVFFAFALFLISALVLLLLRRFLTLRATPAYLIVPIFLALALPASVVLLVPIDLASSSRDGS
GPKAIWLPERMVLVCWRIAYWLIFVLTWVILPLLGEYVDSGYREPKGRLMYSLRSNAKYQMIVLGCALVGLIYVS
ISNGFEFTSIKGLVMALAYVWGLVLAIYLMGHGLVSIPRNLLRNSNVSGRLRRLQAHAPKVHDRLMDSVNELANL
NGQVSQLQRRKTGTARDFQEWIEELREGHGQSDVRAPILESPDTSATIPSVITERYLADLTRRLQRARHMKTRFV
DEWDRLVQLSADLQAIINSAASKKLEFAPAPRRSSCIPRVKFLTPYMRYQLYSNVIPSVRLALGAFFAVASVCIV
WSEMIKSLAPHLSAVSLTVVPHWKDNPVGFGGQLTASAWLLYMCSAALVGVSDVKVWGNRALVRRNTYGESACWY
AGLVARLTVPIAYNFLTFLPKEFRRTTTFYQFLGKLINLTPLGKGFDFIFPIFILLPICATMFNLYGRIKNIFGC
GLAEDDDIHDVENNPAGYGMGGWREGRDLIERELNGFGSLAVSSRGGRSTWASDRDDEGSPGSSRLRLPVAEGSQ
PAQRTVVAPTIVEGEDEEDEGFFQSFAHRVKNTFDTTSTPRWFQGEPFRLPRWMSGDNNPTEEASALFGGRDVPG
RLRLG*
Coding >Pro_DTO377G3_2|g2985.t1
ATGTTTCCCTTATCTGTGTCGCCCATCTCGGTGGGTTCGAACGTCTTTTTCGCATTTGCCCTCTTCCTCATCTCC
GCACTTGTGTTACTTCTCCTGCGACGGTTTCTCACCCTCCGGGCCACCCCCGCGTATTTAATTGTCCCTATATTC
CTAGCTCTAGCTCTGCCAGCTAGTGTTGTGCTTTTGGTCCCCATCGATTTAGCATCCAGTTCGCGGGATGGATCC
GGTCCCAAAGCAATCTGGCTACCGGAACGAATGGTTTTGGTCTGCTGGCGCATTGCCTACTGGTTAATCTTTGTT
CTCACCTGGGTTATCCTCCCATTACTCGGTGAATATGTCGACTCGGGCTACCGTGAACCGAAAGGCCGGCTTATG
TACTCTCTCCGATCGAACGCCAAATACCAGATGATTGTTCTGGGATGTGCTCTGGTAGGGTTGATCTACGTTTCA
ATCTCGAATGGCTTCGAATTCACATCCATCAAAGGTCTCGTCATGGCATTGGCATATGTGTGGGGTCTCGTCCTT
GCCATTTACCTCATGGGTCATGGGCTTGTTTCGATCCCGCGCAATCTGCTCCGAAACTCCAATGTAAGCGGTCGG
CTACGCAGACTCCAGGCCCATGCGCCCAAGGTGCACGATCGCCTGATGGACTCGGTCAATGAGTTAGCGAATCTC
AATGGCCAGGTTTCGCAACTACAACGCCGTAAGACGGGAACCGCTCGTGACTTCCAGGAATGGATTGAAGAGCTT
CGGGAAGGCCACGGCCAATCCGACGTGCGCGCCCCGATCCTCGAGTCACCCGATACATCCGCAACGATACCTTCT
GTCATCACGGAACGCTATCTGGCCGACCTTACACGGCGGCTTCAGCGTGCTCGGCATATGAAGACCCGATTTGTA
GACGAGTGGGATCGGCTAGTCCAATTATCAGCCGATCTGCAAGCCATCATTAATTCTGCAGCTTCAAAGAAGCTG
GAATTTGCACCGGCTCCACGTCGGTCATCCTGCATCCCTCGTGTGAAATTCCTCACCCCGTATATGCGGTACCAG
CTGTATTCCAACGTCATTCCCTCGGTTCGGTTGGCCTTAGGTGCATTCTTCGCAGTGGCATCAGTCTGCATTGTT
TGGTCGGAAATGATCAAGTCTTTGGCGCCCCATCTCTCTGCCGTGAGTTTGACCGTGGTGCCTCACTGGAAGGAC
AATCCAGTTGGCTTTGGTGGTCAACTCACTGCCTCTGCCTGGCTATTGTACATGTGTTCGGCGGCTCTCGTTGGT
GTCAGTGATGTCAAGGTATGGGGAAACCGCGCGCTTGTCCGTCGTAATACATATGGTGAGAGTGCCTGCTGGTAC
GCCGGTCTTGTGGCTCGGTTGACAGTACCAATTGCGTACAACTTCTTGACCTTCTTGCCAAAAGAGTTTAGGCGA
ACGACTACTTTCTACCAATTCCTTGGTAAACTCATCAACCTGACCCCCCTCGGGAAAGGCTTTGATTTCATCTTC
CCAATCTTCATTCTCCTGCCTATCTGCGCAACAATGTTCAACCTGTACGGGCGTATCAAAAACATCTTCGGGTGC
GGCCTTGCAGAGGACGATGATATCCACGATGTCGAAAACAACCCTGCCGGGTATGGCATGGGTGGCTGGCGTGAG
GGTCGCGACCTCATTGAACGGGAATTGAATGGCTTCGGTTCTCTGGCGGTATCCTCCCGTGGTGGTCGCTCAACG
TGGGCGTCGGATCGTGATGATGAAGGTTCCCCTGGGTCATCCAGACTGCGGCTCCCGGTTGCAGAGGGCTCCCAA
CCTGCCCAGAGGACAGTTGTTGCGCCTACTATTGTAGAAGGCGAGGATGAGGAAGACGAGGGCTTCTTCCAGTCC
TTTGCGCATCGTGTCAAAAACACATTTGATACTACCAGCACTCCTCGGTGGTTCCAGGGTGAGCCATTCCGACTT
CCGCGCTGGATGTCGGGTGATAACAATCCCACAGAAGAAGCTTCGGCACTATTCGGAGGTCGGGACGTGCCTGGT
CGTCTGCGCCTAGGTTGA
Transcript >Pro_DTO377G3_2|g2985.t1
ATGTTTCCCTTATCTGTGTCGCCCATCTCGGTGGGTTCGAACGTCTTTTTCGCATTTGCCCTCTTCCTCATCTCC
GCACTTGTGTTACTTCTCCTGCGACGGTTTCTCACCCTCCGGGCCACCCCCGCGTATTTAATTGTCCCTATATTC
CTAGCTCTAGCTCTGCCAGCTAGTGTTGTGCTTTTGGTCCCCATCGATTTAGCATCCAGTTCGCGGGATGGATCC
GGTCCCAAAGCAATCTGGCTACCGGAACGAATGGTTTTGGTCTGCTGGCGCATTGCCTACTGGTTAATCTTTGTT
CTCACCTGGGTTATCCTCCCATTACTCGGTGAATATGTCGACTCGGGCTACCGTGAACCGAAAGGCCGGCTTATG
TACTCTCTCCGATCGAACGCCAAATACCAGATGATTGTTCTGGGATGTGCTCTGGTAGGGTTGATCTACGTTTCA
ATCTCGAATGGCTTCGAATTCACATCCATCAAAGGTCTCGTCATGGCATTGGCATATGTGTGGGGTCTCGTCCTT
GCCATTTACCTCATGGGTCATGGGCTTGTTTCGATCCCGCGCAATCTGCTCCGAAACTCCAATGTAAGCGGTCGG
CTACGCAGACTCCAGGCCCATGCGCCCAAGGTGCACGATCGCCTGATGGACTCGGTCAATGAGTTAGCGAATCTC
AATGGCCAGGTTTCGCAACTACAACGCCGTAAGACGGGAACCGCTCGTGACTTCCAGGAATGGATTGAAGAGCTT
CGGGAAGGCCACGGCCAATCCGACGTGCGCGCCCCGATCCTCGAGTCACCCGATACATCCGCAACGATACCTTCT
GTCATCACGGAACGCTATCTGGCCGACCTTACACGGCGGCTTCAGCGTGCTCGGCATATGAAGACCCGATTTGTA
GACGAGTGGGATCGGCTAGTCCAATTATCAGCCGATCTGCAAGCCATCATTAATTCTGCAGCTTCAAAGAAGCTG
GAATTTGCACCGGCTCCACGTCGGTCATCCTGCATCCCTCGTGTGAAATTCCTCACCCCGTATATGCGGTACCAG
CTGTATTCCAACGTCATTCCCTCGGTTCGGTTGGCCTTAGGTGCATTCTTCGCAGTGGCATCAGTCTGCATTGTT
TGGTCGGAAATGATCAAGTCTTTGGCGCCCCATCTCTCTGCCGTGAGTTTGACCGTGGTGCCTCACTGGAAGGAC
AATCCAGTTGGCTTTGGTGGTCAACTCACTGCCTCTGCCTGGCTATTGTACATGTGTTCGGCGGCTCTCGTTGGT
GTCAGTGATGTCAAGGTATGGGGAAACCGCGCGCTTGTCCGTCGTAATACATATGGTGAGAGTGCCTGCTGGTAC
GCCGGTCTTGTGGCTCGGTTGACAGTACCAATTGCGTACAACTTCTTGACCTTCTTGCCAAAAGAGTTTAGGCGA
ACGACTACTTTCTACCAATTCCTTGGTAAACTCATCAACCTGACCCCCCTCGGGAAAGGCTTTGATTTCATCTTC
CCAATCTTCATTCTCCTGCCTATCTGCGCAACAATGTTCAACCTGTACGGGCGTATCAAAAACATCTTCGGGTGC
GGCCTTGCAGAGGACGATGATATCCACGATGTCGAAAACAACCCTGCCGGGTATGGCATGGGTGGCTGGCGTGAG
GGTCGCGACCTCATTGAACGGGAATTGAATGGCTTCGGTTCTCTGGCGGTATCCTCCCGTGGTGGTCGCTCAACG
TGGGCGTCGGATCGTGATGATGAAGGTTCCCCTGGGTCATCCAGACTGCGGCTCCCGGTTGCAGAGGGCTCCCAA
CCTGCCCAGAGGACAGTTGTTGCGCCTACTATTGTAGAAGGCGAGGATGAGGAAGACGAGGGCTTCTTCCAGTCC
TTTGCGCATCGTGTCAAAAACACATTTGATACTACCAGCACTCCTCGGTGGTTCCAGGGTGAGCCATTCCGACTT
CCGCGCTGGATGTCGGGTGATAACAATCCCACAGAAGAAGCTTCGGCACTATTCGGAGGTCGGGACGTGCCTGGT
CGTCTGCGCCTAGGTTGA
Gene >Pro_DTO377G3_2|g2985.t1
ATGTTTCCCTTATCTGTGTCGCCCATCTCGGTGGGTTCGAACGTCTTTTTCGCATTTGCCCTCTTCCTCATCTCC
GCACTTGTGTTACTTCTCCTGCGACGGTTTCTCACCCTCCGGGCCACCCCCGCGTATTTAATTGTCCCTATATTC
CTAGCTCTAGCTCTGCCAGCTAGTGTTGTGCTTTTGGTCCCCATCGATTTAGCATCCAGTTCGCGGGATGGATCC
GGTCCCAAAGCAATCTGGCTACCGGAACGAATGGTTTTGGTCTGCTGGCGCATTGCCTACTGGTTAATCTTTGTT
CTCACCTGGTAAGTGTACTGCGCTCTTCATAACCAATGGCTGTCACTCATTCTTATCTCTCTTCCAGGGTTATCC
TCCCATTACTCGGTGAATATGTCGACTCGGGCTACCGTGAACCGAAAGGCCGGCTTATGTACTCTCTCCGATCGA
ACGCCAAATACCAGATGATTGTTCTGGGATGTGCTCTGGTAGGGTTGATCTACGTTTCAATCTCGAATGGCTTCG
AATTCACATCCATCAAAGGTCTCGTCATGGCATTGGCATATGTGTGGGGTCTCGTCCTTGCCATTTACCTCATGG
GTCATGGGCTTGTTTCGATCCCGCGCAATCTGCTCCGAAACTCCAATGTAAGCGGTCGGCTACGCAGACTCCAGG
CCCATGCGCCCAAGGTGCACGATCGCCTGATGGACTCGGTCAATGAGTTAGCGAATCTCAATGGCCAGGTTTCGC
AACTACAACGCCGTAAGACGGGAACCGCTCGTGACTTCCAGGAATGGATTGAAGAGCTTCGGGAAGGCCACGGCC
AATCCGACGTGCGCGCCCCGATCCTCGAGTCACCCGATACATCCGCAACGATACCTTCTGTCATCACGGAACGCT
ATCTGGCCGACCTTACACGGCGGCTTCAGCGTGCTCGGCATATGAAGACCCGATTTGTAGACGAGTGGGATCGGC
TAGTCCAATTATCAGCCGATCTGCAAGCCATCATTAATTCTGCAGCTTCAAAGAAGCTGGAATTTGCACCGGCTC
CACGTCGGTCATCCTGCATCCCTCGTGTGAAATTCCTCACCCCGTATATGCGGTACCAGCTGTATTCCAACGTCA
TTCCCTCGGTTCGGTTGGCCTTAGGTGCATTCTTCGCAGTGGCATCAGTCTGCATTGTTTGGTCGGAAATGATCA
AGTCTTTGGCGCCCCATCTCTCTGCCGTGAGTTTGACCGTGGTGCCTCACTGGAAGGACAATCCAGTTGGCTTTG
GTGGTCAACTCACTGCCTCTGCCTGGCTATTGTACATGTGTTCGGCGGCTCTCGTTGGTGTCAGTGATGTCAAGG
TATGGGGAAACCGCGCGCTTGTCCGTCGTAATACATATGGTGAGAGTGCCTGCTGGTACGCCGGTCTTGTGGCTC
GGTTGACAGTACCAATTGCGTACAACTTCTTGACCTTCTTGCCAAAAGAGTTTAGGCGAACGACTACTTTCTACC
AATTCCTTGGTAAACTCATCAACCTGACCCCCCTCGGGAAAGGCTTTGATTTCATCTTCCCAATCTTCATTCTCC
TGCCTATCTGCGCAACAATGTTCAACCTGTACGGGCGTATCAAAAACATCTTCGGGTGCGGCCTTGCAGAGGACG
ATGATATCCACGATGTCGAAAACAACCCTGCCGGGTATGGCATGGGTGGCTGGCGTGAGGGTCGCGACCTCATTG
AACGGGAATTGAATGGCTTCGGTTCTCTGGCGGTATCCTCCCGTGGTGGTCGCTCAACGTGGGCGTCGGATCGTG
ATGATGAAGGTTCCCCTGGGTCATCCAGACTGCGGCTCCCGGTTGCAGAGGGCTCCCAACCTGCCCAGAGGACAG
TTGTTGCGCCTACTATTGTAGAAGGCGAGGATGAGGAAGACGAGGGCTTCTTCCAGTCCTTTGCGCATCGTGTCA
AAAACACATTTGATACTACCAGCACTCCTCGGTGGTTCCAGGGTGAGCCATTCCGACTTCCGCGCTGGATGTCGG
GTGATAACAATCCCACAGAAGAAGCTTCGGCACTATTCGGAGGTCGGGACGTGCCTGGTCGTCTGCGCCTAGGTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail