Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2983.t1
Gene name
Locationscaffold_04:393279..394801
Strand-
Gene length (bp)1522
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 2.2E-07 130 209
PF04142 Nuc_sug_transp Nucleotide-sugar transporter 2.6E-09 141 216
PF08449 UAA UAA transporter family 1.0E-06 129 409

GO

GO Term Description Terminal node
GO:0090481 pyrimidine nucleotide-sugar transmembrane transport Yes
GO:0055085 transmembrane transport Yes
GO:0000139 Golgi membrane Yes
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0015165 pyrimidine nucleotide-sugar transmembrane transporter activity Yes
GO:0071702 organic substance transport No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0098588 bounding membrane of organelle No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0015780 nucleotide-sugar transmembrane transport No
GO:1901264 carbohydrate derivative transport No
GO:0003674 molecular_function No
GO:0031090 organelle membrane No
GO:0005338 nucleotide-sugar transmembrane transporter activity No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0015931 nucleobase-containing compound transport No
GO:0005215 transporter activity No
GO:0071705 nitrogen compound transport No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 52 74 22
3 165 187 22
4 194 216 22
5 251 273 22
6 294 316 22
7 336 355 19
8 376 398 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2983.t1
MANHALIPLLVTMMLVTGVCNTILNKYQDMQCVRNCDSPDPSQRKLFEQPVIQTAVMFMGEMGCWLVVGLTFLYR
QYIAPRLSSDPSPLLTGGYHPINGDDEGIDHEDDNIVDELDSDSRHPKPLPEDDSRIPLRGWKILLLAAPSSCDI
AGTTLMNVGLLFVAASIYQMTRGALVLFVGLFSVLFLRRKLHLYQWSALFIVVLGVAIVGLSGALFSGDSDHDIT
QDGSASNAVSHGLMQARVVARTPEAVQAIIGVLLIAAAQIFTATQFVLEEWILENYAMEPIHVVGWEGVFGFLVT
VVGMVIMYLAVGRTDAGRYGYFDVKQGLHEVLNNRAVAISSLFIMISIGGFNFFGLSVTRTVSATSRSTIDTCRT
LFIWIVSLGLGWETFKWLQVAGFALLVYGTFMFNDIVRPPLKACLPGDRREGEVLLPEGPIEHI*
Coding >Pro_DTO377G3_2|g2983.t1
ATGGCGAACCATGCCCTCATTCCCCTCCTGGTCACGATGATGCTCGTGACTGGGGTGTGCAACACCATTCTCAAC
AAGTATCAGGATATGCAATGTGTGCGAAACTGCGATTCCCCAGATCCCAGCCAGCGAAAGCTGTTCGAGCAGCCA
GTCATTCAGACAGCCGTAATGTTTATGGGTGAAATGGGCTGTTGGCTAGTTGTCGGCTTAACCTTCCTCTACCGC
CAATACATCGCACCGCGCCTATCCAGTGACCCCTCACCCCTCCTAACTGGCGGATATCACCCGATAAACGGCGAT
GATGAAGGCATCGATCATGAGGATGACAACATAGTCGATGAACTCGACAGCGATAGCAGACACCCCAAGCCCCTA
CCCGAAGATGACAGCCGCATCCCACTCCGCGGATGGAAGATCCTACTTCTTGCAGCGCCATCTAGCTGCGATATC
GCCGGCACAACCCTCATGAACGTGGGTCTTCTCTTTGTGGCAGCCAGTATCTACCAGATGACCCGGGGTGCCCTG
GTTCTATTTGTAGGCCTGTTCAGTGTCCTCTTCCTTCGCCGCAAGCTCCACTTATACCAGTGGAGTGCACTCTTC
ATTGTCGTTCTAGGTGTGGCTATTGTGGGTCTTTCCGGAGCTCTATTCAGTGGAGATTCAGACCACGATATCACT
CAGGATGGGAGTGCTAGCAATGCAGTCTCGCATGGTCTTATGCAGGCGCGTGTCGTTGCTCGGACCCCCGAGGCT
GTCCAGGCTATCATTGGTGTGCTGCTTATTGCCGCAGCGCAGATCTTCACAGCCACACAATTTGTGTTGGAGGAG
TGGATTTTGGAGAATTACGCCATGGAACCGATCCATGTTGTGGGTTGGGAAGGTGTGTTCGGATTTTTGGTTACT
GTCGTTGGCATGGTGATCATGTATCTTGCTGTCGGACGGACCGATGCCGGCCGATATGGCTACTTTGATGTCAAG
CAGGGATTGCACGAGGTTCTTAATAACCGTGCTGTTGCCATATCCAGCTTGTTTATCATGATCAGTATCGGTGGC
TTCAACTTCTTCGGTCTGTCTGTCACCCGCACTGTGTCTGCTACCTCTCGTAGCACAATCGACACCTGCCGCACA
CTCTTCATCTGGATTGTCTCGCTTGGACTCGGCTGGGAGACCTTCAAATGGCTCCAAGTTGCCGGATTCGCGCTT
CTTGTCTATGGAACTTTCATGTTCAATGACATCGTCCGTCCTCCGCTCAAGGCTTGTTTGCCCGGTGACCGGAGA
GAGGGAGAGGTGCTACTTCCCGAAGGCCCCATTGAGCATATCTGA
Transcript >Pro_DTO377G3_2|g2983.t1
ATGGCGAACCATGCCCTCATTCCCCTCCTGGTCACGATGATGCTCGTGACTGGGGTGTGCAACACCATTCTCAAC
AAGTATCAGGATATGCAATGTGTGCGAAACTGCGATTCCCCAGATCCCAGCCAGCGAAAGCTGTTCGAGCAGCCA
GTCATTCAGACAGCCGTAATGTTTATGGGTGAAATGGGCTGTTGGCTAGTTGTCGGCTTAACCTTCCTCTACCGC
CAATACATCGCACCGCGCCTATCCAGTGACCCCTCACCCCTCCTAACTGGCGGATATCACCCGATAAACGGCGAT
GATGAAGGCATCGATCATGAGGATGACAACATAGTCGATGAACTCGACAGCGATAGCAGACACCCCAAGCCCCTA
CCCGAAGATGACAGCCGCATCCCACTCCGCGGATGGAAGATCCTACTTCTTGCAGCGCCATCTAGCTGCGATATC
GCCGGCACAACCCTCATGAACGTGGGTCTTCTCTTTGTGGCAGCCAGTATCTACCAGATGACCCGGGGTGCCCTG
GTTCTATTTGTAGGCCTGTTCAGTGTCCTCTTCCTTCGCCGCAAGCTCCACTTATACCAGTGGAGTGCACTCTTC
ATTGTCGTTCTAGGTGTGGCTATTGTGGGTCTTTCCGGAGCTCTATTCAGTGGAGATTCAGACCACGATATCACT
CAGGATGGGAGTGCTAGCAATGCAGTCTCGCATGGTCTTATGCAGGCGCGTGTCGTTGCTCGGACCCCCGAGGCT
GTCCAGGCTATCATTGGTGTGCTGCTTATTGCCGCAGCGCAGATCTTCACAGCCACACAATTTGTGTTGGAGGAG
TGGATTTTGGAGAATTACGCCATGGAACCGATCCATGTTGTGGGTTGGGAAGGTGTGTTCGGATTTTTGGTTACT
GTCGTTGGCATGGTGATCATGTATCTTGCTGTCGGACGGACCGATGCCGGCCGATATGGCTACTTTGATGTCAAG
CAGGGATTGCACGAGGTTCTTAATAACCGTGCTGTTGCCATATCCAGCTTGTTTATCATGATCAGTATCGGTGGC
TTCAACTTCTTCGGTCTGTCTGTCACCCGCACTGTGTCTGCTACCTCTCGTAGCACAATCGACACCTGCCGCACA
CTCTTCATCTGGATTGTCTCGCTTGGACTCGGCTGGGAGACCTTCAAATGGCTCCAAGTTGCCGGATTCGCGCTT
CTTGTCTATGGAACTTTCATGTTCAATGACATCGTCCGTCCTCCGCTCAAGGCTTGTTTGCCCGGTGACCGGAGA
GAGGGAGAGGTGCTACTTCCCGAAGGCCCCATTGAGCATATCTGA
Gene >Pro_DTO377G3_2|g2983.t1
ATGGCGAACCATGCCCTCATTCCCCTCCTGGTCACGATGATGCTCGTGACTGGGGTGTGCAACACCATTCTCAAC
AAGTATCAGGTGCGTCCTTGATTCGATTCAAGCTACAAAGAAACACGAACTAATTGATTGGCCCGTCTCAAAAAG
GATATGCAATGTGTGCGAAACTGCGATTCCCCAGATCCCAGCCAGCGAAAGCTGTTCGAGCAGCCAGTCATTCAG
ACGTAGGCTCCACCCCGTGCCGATGATACAGCCTTACAACGCTAGCGATTAATGCTGACACCAGGCGGTAATGCA
GAGCCGTAATGTTTATGGGTGAAATGGGCTGTTGGCTAGTTGTCGGCTTAACCTTCCTCTACCGCCAATACATCG
CACCGCGCCTATCCAGTGACCCCTCACCCCTCCTAACTGGCGGATATCACCCGATAAACGGCGATGATGAAGGCA
TCGATCATGAGGATGACAACATAGTCGATGAACTCGACAGCGATAGCAGACACCCCAAGCCCCTACCCGAAGATG
ACAGCCGCATCCCACTCCGCGGATGGAAGATCCTACTTCTTGCAGCGCCATCTAGCTGCGATATCGCCGGCACAA
CCCTCATGAACGTGGGTCTTCTCTTTGTGGCAGCCAGTATCTACCAGATGACCCGGGGTGCCCTGGTTCTATTTG
TAGGCCTGTTCAGTGTCCTCTTCCTTCGCCGCAAGCTCCACTTATACCAGTGGAGTGCACTCTTCATTGTCGTTC
TAGGTGTGGCTATTGTGGGTCTTTCCGGAGCTCTATTCAGTGGAGATTCAGACCACGATATCACTCAGGATGGGA
GTGCTAGCAATGCAGTCTCGCATGGTCTTATGCAGGCGCGTGTCGTTGCTCGGACCCCCGAGGCTGTCCAGGCTA
TCATTGGTGTGCTGCTTATTGCCGCAGCGCAGATCTTCACAGCCACACAATTTGTGTTGGAGGAGTGGATTTTGG
AGAATTACGCCATGGAACCGATCCATGTTGTGGGTTGGGAAGGTGTGTTCGGATTTTTGGTTACTGTCGTTGGCA
TGGTGATCATGTATCTTGCTGTCGGACGGACCGATGCCGGCCGATATGGCTACTTTGATGTCAAGCAGGGATTGC
ACGAGGTTCTTAATAACCGTGCTGTTGCCATATCCAGCTTGTTTATCATGATCAGTATCGGGTATGTGTTGATCT
TGCTTCTCAACTCCATTTTTCCGCCCTCCCCTCTAACGTTCGTTCTAGTGGCTTCAACTTCTTCGGTCTGTCTGT
CACCCGCACTGTGTCTGCTACCTCTCGTAGCACAATCGACACCTGCCGCACACTCTTCATCTGGATTGTCTCGCT
TGGACTCGGCTGGGAGACCTTCAAATGGCTCCAAGTTGCCGGATTCGCGCTTCTTGTCTATGGAACTTTCATGTT
CAATGACATCGTCCGTCCTCCGCTCAAGGCTTGTTTGCCCGGTGACCGGAGAGAGGGAGAGGTGCTACTTCCCGA
AGGCCCCATTGAGCATATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail