Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2981.t1
Gene name
Locationscaffold_04:387236..389144
Strand-
Gene length (bp)1908
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 9.2E-41 281 531

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 98 117 19
2 132 154 22
3 167 189 22
4 199 221 22
5 330 352 22
6 383 405 22
7 481 498 17
8 513 532 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2981.t1
MSSAVSQDESAALRPRAVPIQPNGKSDVAHPLPVDKLIQDISGHSTPISEDAPPSAHSISSARKQVRARNGLFYT
IDYVPRVSHFDPDSDYHNFRGFFTLFWIGLAIMVGTSILRNIKDTGFPLQVRVWSLLTANVWGMGLSDAAMVISS
GLVLPMHQLWRSGPQWLRWSRGGMLLQSLCEALWLVLWINWPFMMKWTWTAQVFFTLHTLTILMKLHSYAFYNGH
LSETERRLASLDKPGLKSPEPPAAIHYPEVHRRRPSMKKPNEDQSAEPLERLREDLATELTSPLGNISYPQNLHV
GNYVDFLFCPTLCYELEYPRRKERRWSEIGWKAAAVFGCIFLLTLTSEEFIVPVLSVASAQLRAVSSVTDKALIL
AETISMLLFPFMIIFLLVFLVIFEYVLGAFAELTRFADRHFYADWWNSCDWMEFSREWNVPVHHFLFRHVYWPAR
SNFSQPVAMFITFLVSSVFHELVMSCITKKLRGYGFLAMMLQLPIVAIQKSRFFRGRTILNNAVFWFSMILGLSM
MCAFYVLV*
Coding >Pro_DTO377G3_2|g2981.t1
ATGTCTAGCGCCGTCTCACAGGATGAGTCTGCAGCTCTGCGGCCGCGCGCCGTGCCGATACAGCCGAATGGGAAG
TCCGACGTGGCGCACCCTCTTCCAGTGGACAAGCTGATTCAGGATATAAGTGGCCACTCAACCCCTATTTCCGAA
GATGCTCCCCCGTCAGCGCATTCGATCTCATCCGCGAGGAAGCAAGTCCGCGCCCGCAATGGCCTGTTTTATACA
ATAGACTATGTGCCTCGTGTGTCACATTTTGATCCCGATAGCGACTATCACAACTTCCGAGGGTTCTTCACTCTC
TTTTGGATTGGCTTGGCCATCATGGTCGGGACCAGCATCTTGCGCAATATCAAGGATACCGGATTCCCCCTGCAG
GTGCGCGTTTGGAGTCTCTTGACGGCCAATGTGTGGGGGATGGGGCTCAGCGATGCGGCCATGGTGATAAGCTCA
GGGCTCGTCCTGCCTATGCACCAACTGTGGCGAAGTGGTCCTCAGTGGCTGCGATGGTCGCGCGGAGGTATGCTC
TTACAGAGCTTGTGCGAAGCACTTTGGTTGGTTTTATGGATAAACTGGCCCTTCATGATGAAATGGACCTGGACT
GCACAGGTGTTCTTCACGCTGCACACTCTGACCATTCTGATGAAACTGCACTCATACGCTTTCTATAATGGACAT
CTCAGCGAGACAGAGCGCCGCCTTGCCTCGCTCGATAAGCCAGGCCTAAAGTCACCTGAGCCCCCTGCTGCCATC
CATTATCCAGAGGTACACCGACGTCGGCCGTCAATGAAGAAGCCCAACGAAGACCAGTCCGCAGAGCCATTGGAG
AGACTGCGTGAAGACCTGGCCACGGAGTTGACCTCCCCGCTAGGCAACATCTCATACCCGCAGAATCTGCACGTT
GGAAATTATGTGGACTTCCTCTTTTGTCCGACTCTTTGCTATGAGCTAGAGTATCCCCGCCGAAAGGAGCGACGC
TGGTCAGAAATTGGCTGGAAGGCCGCTGCTGTATTTGGCTGCATCTTCCTGCTCACCCTGACAAGCGAGGAATTC
ATCGTCCCCGTGTTGTCAGTGGCCAGCGCCCAACTCCGTGCCGTCTCTAGCGTCACAGACAAGGCTCTCATCCTT
GCTGAAACCATCAGCATGCTCCTCTTCCCCTTCATGATTATCTTCTTGCTAGTATTCCTCGTCATCTTCGAATAT
GTGCTGGGTGCATTTGCAGAGCTGACTCGGTTCGCCGATCGCCACTTCTATGCAGACTGGTGGAATTCCTGTGAC
TGGATGGAATTTTCCCGCGAGTGGAACGTCCCTGTCCATCACTTCCTCTTCCGCCATGTCTACTGGCCTGCCCGA
TCTAACTTCTCTCAACCCGTGGCTATGTTTATCACATTTTTGGTCAGCTCTGTATTCCACGAGCTAGTTATGAGC
TGCATTACCAAGAAGCTTCGGGGATACGGTTTCCTGGCTATGATGCTTCAGCTGCCTATTGTTGCGATTCAAAAG
TCTCGCTTTTTCCGTGGCCGGACAATCCTCAATAATGCGGTATTCTGGTTCTCAATGATATTGGGTCTGTCTATG
ATGTGTGCATTCTACGTCCTTGTTTAA
Transcript >Pro_DTO377G3_2|g2981.t1
ATGTCTAGCGCCGTCTCACAGGATGAGTCTGCAGCTCTGCGGCCGCGCGCCGTGCCGATACAGCCGAATGGGAAG
TCCGACGTGGCGCACCCTCTTCCAGTGGACAAGCTGATTCAGGATATAAGTGGCCACTCAACCCCTATTTCCGAA
GATGCTCCCCCGTCAGCGCATTCGATCTCATCCGCGAGGAAGCAAGTCCGCGCCCGCAATGGCCTGTTTTATACA
ATAGACTATGTGCCTCGTGTGTCACATTTTGATCCCGATAGCGACTATCACAACTTCCGAGGGTTCTTCACTCTC
TTTTGGATTGGCTTGGCCATCATGGTCGGGACCAGCATCTTGCGCAATATCAAGGATACCGGATTCCCCCTGCAG
GTGCGCGTTTGGAGTCTCTTGACGGCCAATGTGTGGGGGATGGGGCTCAGCGATGCGGCCATGGTGATAAGCTCA
GGGCTCGTCCTGCCTATGCACCAACTGTGGCGAAGTGGTCCTCAGTGGCTGCGATGGTCGCGCGGAGGTATGCTC
TTACAGAGCTTGTGCGAAGCACTTTGGTTGGTTTTATGGATAAACTGGCCCTTCATGATGAAATGGACCTGGACT
GCACAGGTGTTCTTCACGCTGCACACTCTGACCATTCTGATGAAACTGCACTCATACGCTTTCTATAATGGACAT
CTCAGCGAGACAGAGCGCCGCCTTGCCTCGCTCGATAAGCCAGGCCTAAAGTCACCTGAGCCCCCTGCTGCCATC
CATTATCCAGAGGTACACCGACGTCGGCCGTCAATGAAGAAGCCCAACGAAGACCAGTCCGCAGAGCCATTGGAG
AGACTGCGTGAAGACCTGGCCACGGAGTTGACCTCCCCGCTAGGCAACATCTCATACCCGCAGAATCTGCACGTT
GGAAATTATGTGGACTTCCTCTTTTGTCCGACTCTTTGCTATGAGCTAGAGTATCCCCGCCGAAAGGAGCGACGC
TGGTCAGAAATTGGCTGGAAGGCCGCTGCTGTATTTGGCTGCATCTTCCTGCTCACCCTGACAAGCGAGGAATTC
ATCGTCCCCGTGTTGTCAGTGGCCAGCGCCCAACTCCGTGCCGTCTCTAGCGTCACAGACAAGGCTCTCATCCTT
GCTGAAACCATCAGCATGCTCCTCTTCCCCTTCATGATTATCTTCTTGCTAGTATTCCTCGTCATCTTCGAATAT
GTGCTGGGTGCATTTGCAGAGCTGACTCGGTTCGCCGATCGCCACTTCTATGCAGACTGGTGGAATTCCTGTGAC
TGGATGGAATTTTCCCGCGAGTGGAACGTCCCTGTCCATCACTTCCTCTTCCGCCATGTCTACTGGCCTGCCCGA
TCTAACTTCTCTCAACCCGTGGCTATGTTTATCACATTTTTGGTCAGCTCTGTATTCCACGAGCTAGTTATGAGC
TGCATTACCAAGAAGCTTCGGGGATACGGTTTCCTGGCTATGATGCTTCAGCTGCCTATTGTTGCGATTCAAAAG
TCTCGCTTTTTCCGTGGCCGGACAATCCTCAATAATGCGGTATTCTGGTTCTCAATGATATTGGGTCTGTCTATG
ATGTGTGCATTCTACGTCCTTGTTTAA
Gene >Pro_DTO377G3_2|g2981.t1
ATGTCTAGCGCCGTCTCACAGGATGAGTCTGCAGCTCTGCGGCCGCGCGCCGTGCCGATACAGCCGAATGGGAAG
TCCGACGTGGCGCACCCTCTTCCAGTGGACAAGCTGATTCAGGATATAAGGTAATTTGCTCTCAACTTGCACCAG
ACTGGATCTAAATAGCTAATCTGTTTGTCACATTAGTGGCCACTCAACCCCTATTTCCGAAGATGCTCCCCCGTC
AGCGCATTCGATCTCATCCGCGAGGAAGCAAGTCCGCGCCCGCAATGGCCTGTTTTATACAATAGACTATGTGCC
TCGTGTGTCACATTTTGATCCCGATAGCGACTATCACAACTTCCGAGGGTTCTTCACTCTCTTTTGGATTGGCTT
GGCCATCATGGTCGGGACCAGCATCTTGCGCAATATCAAGGATACCGGATTCCCCCTGCAGGTGCGCGTTTGGAG
TCTCTTGACGGCCAATGTGTGGGGGATGGGGCTCAGCGATGCGGCCATGGTGATAAGCTCAGGGCTCGTCCTGCC
TATGCACCAACTGTGGCGAAGTGGTCCTCAGTGGCTGCGATGGTCGCGCGGAGGTATGCTCTTACAGAGCTTGTG
CGAAGCACTTTGGTTGGTTTTATGGATAAAGTGAGTTAGTAGCTGGTTTTTGCGCTGGAGCTCAGAGCGCTGACA
TGAGAAAAACAGCTGGCCCTTCATGATGAAATGGACCTGGACTGCACAGGTGTTCTTCACGCTGCACACTCTGAC
CATTCTGATGAAACTGCACTCATACGCTTTCTATAATGGACATCTCAGCGAGACAGAGCGCCGCCTTGCCTCGCT
CGATAAGCCAGGCCTAAAGTCACCTGAGCCCCCTGCTGCCATCCATTATCCAGAGGTACACCGACGTCGGCCGTC
AATGAAGAAGCCCAACGAAGACCAGTCCGCAGAGCCATTGGAGAGACTGCGTGAAGACCTGGCCACGGAGTTGAC
CTCCCCGCTAGGCAACATCTCATACCCGCAGAATCTGCACGTTGGAAATTATGTGGACTTCCTCTTTTGTCCGAC
TCTTTGCTATGAGCTAGAGTATCCCCGCCGAAAGGAGCGACGCTGGTCAGAAATTGGCTGGAAGGCCGCTGCTGT
ATTTGGCTGCATCTTCCTGCTCACCCTGACAAGCGAGGAATTCATCGTCCCCGTGTTGTCAGTGGCCAGCGCCCA
ACTCCGTGCCGTCTCTAGCGTCACAGACAAGGCTCTCATCCTTGCTGAAACCATCAGCATGCTCCTCTTCCCCTT
CATGATTATCTTCTTGCTAGTATTCCTCGTCATCTTCGAATATGTGCTGGGTGCATTTGCAGAGCTGACTCGGTT
CGCCGATCGCCACTTCTATGCAGACTGGTGGAATTCCTGTGACTGGTAAGTTGAAATTACGCTCCTAAGAGTCTG
AGTGATATGACTAACCGGCTTCTACATAGGATGGAATTTTCCCGCGAGTGGAACGTCCCTGTCCATCACTTCCTC
TTCCGCCATGTCTACTGGCCTGCCCGATCTAACTTCTCTCAACCCGTGGCTATGTTTATCACATTTTTGGTCAGC
TCTGTATTCCACGAGCTAGTTATGAGCTGCATTACCAAGAAGCTTCGGGGATACGGTTTCCTGGCTATGATGCTT
CAGCTGCCTATTGTTGCGATTCAAAAGTCTCGCTTTTTCCGTGGCCGGACAATCCTCAATGTAAGCTGTTATATG
ATTGCTTTAATATTCTGCGATTTTCACTGACTTCCTTCCTAGAATGCGGTATTCTGGTTCTCAATGATATTGGGT
CTGTCTATGGTAAGCCCTACTTCTTCACTCTGAATATGCAACACCCCAGTATATTTAGTTCTAACCCTGTGTGAT
TTTTAGATGTGTGCATTCTACGTCCTTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail