Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2975.t1
Gene name
Locationscaffold_04:368108..371072
Strand-
Gene length (bp)2964
Transcript length (bp)2964
Coding sequence length (bp)2964
Protein length (aa) 988

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 2.2E-33 161 335

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 384 406 22
3 435 457 22
4 472 491 19
5 503 522 19
6 532 554 22
7 655 677 22
8 687 709 22
9 716 738 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2975.t1
MATQKARNPLAFTPWPVTIITTVVYLALIIPLLVIHHIVPPAPQTSPNGLNLTEAWQDLQSLTTGFHPYNSHQND
VVRSWLLERIDAIKQSAASTEEYRDAKEEKPDVFVFDDLVSNLTFIDKSVGVYFEGTNILVYIRGSEDSKQNWWE
TPGRVPVGKGGVLVNAHYDSVSTGYGATDDGVGVVTCLQLVKYFLTPGHAPRRGLVVLFNNGEEDYLNGARAYSQ
HPMALFAHTFLNLEGAGAGGRATLFRSSDTEVTQAYAKSQHPFGSVLSANGFEKGLIGSQTDYIVLEGILGLRGL
DVAFFEPRARYHTDQDDARHTNIDSLWHMLSTAVATTEELLSDATDRFDGHLRDDGNVPSGSGTRAVWFDLFGSA
FAIFRLHTLFALSVTLLIVAPLTLLITSIILSRADKMYLFRSSVYSEINDDNIPLRGLRGFFRFPFLLLIPTAVT
VGLAYMVTKVNPFIAHSSSYAVWSMMISAWIFLAWFVSRIADFARPSAFHRVYTWTWMFVLTWSLMVVGTVYEHE
EGLAGGYFMFFYFAGTFLATWISYLELFSLPTKSEYAARLFESRRPSTQGSRLATSGDEDQDDDTEEDLTESTSL
LHGRHRPTFANYVRVGVDRGSHEQDEEDEEKDPNVYEDEQGWSGVLPRWTWLLQLLITAPVILMLIVPLALLITS
ALSQTGQDGNPQLIVYLFISSLTVLLFAPILPFIHRYTYHLPIFLLFVFIGTLIYNLVAFPFADSNRLKLFFLQE
VDLDNGMSTASLTGMPPFVKEVTYGLPSAAGQNEACDWIFRGSNRVQRCSWNAPIPHVVPSPESLSLPNEGADSL
LEASELSPDWISFNISHPQSDSSSVRFEVSGQNTRNCRINMDGNYITDFSVVGSSAPDQRFINPSPDGLSRIQLW
SRTWDNKWTVDVDFSKHESSEADGNSSITGRITCLWSDNNRIGLIPALDEVRQFSPAWVAVTKFSDGLIEGSRAF
EIKRSSLGTLRS*
Coding >Pro_DTO377G3_2|g2975.t1
ATGGCTACCCAGAAGGCCAGAAATCCTCTGGCATTTACGCCGTGGCCAGTAACAATCATCACCACGGTCGTATAC
CTCGCCTTGATTATCCCATTGCTGGTGATCCACCACATTGTCCCGCCCGCGCCCCAAACAAGCCCCAACGGCCTT
AACCTCACAGAGGCATGGCAAGATCTCCAAAGCCTGACAACAGGCTTTCACCCCTACAATTCGCACCAGAATGAC
GTGGTCCGCTCGTGGTTGCTCGAACGCATCGACGCGATCAAGCAGTCCGCCGCATCCACCGAGGAATACCGCGAC
GCGAAGGAAGAGAAGCCCGATGTTTTTGTTTTCGACGATCTGGTATCTAACCTGACTTTCATCGATAAAAGCGTC
GGTGTTTACTTTGAAGGCACCAATATCTTGGTCTACATTCGCGGCTCGGAAGATAGTAAGCAGAATTGGTGGGAG
ACTCCCGGACGAGTGCCCGTTGGCAAGGGAGGAGTACTTGTCAACGCGCACTACGATAGCGTTTCGACCGGGTAC
GGAGCGACAGACGATGGAGTTGGTGTCGTAACGTGCCTGCAGCTGGTGAAATACTTCCTGACGCCGGGCCATGCG
CCGCGCCGCGGGTTGGTGGTTCTTTTCAACAATGGCGAGGAGGACTATCTGAACGGCGCACGCGCGTACAGTCAG
CATCCGATGGCGCTATTTGCACACACATTCCTGAACCTGGAAGGTGCGGGTGCTGGAGGGCGTGCTACATTATTC
CGCAGCTCGGATACGGAGGTCACCCAGGCGTATGCGAAATCACAGCACCCATTCGGCTCAGTGTTGAGTGCCAAC
GGGTTCGAAAAGGGTTTGATTGGCAGCCAGACGGATTACATCGTCCTGGAAGGTATCTTGGGCCTGCGCGGTTTG
GATGTCGCTTTCTTTGAACCAAGAGCTCGTTATCATACCGATCAGGATGATGCTCGACACACTAATATCGACTCG
CTTTGGCACATGCTCTCTACTGCTGTTGCTACGACGGAGGAGCTTTTGTCTGACGCTACTGATCGATTCGACGGA
CATCTCCGCGACGATGGAAATGTGCCTAGCGGCTCAGGTACCCGGGCTGTTTGGTTCGATCTGTTTGGGAGTGCT
TTTGCCATCTTCCGTCTGCACACACTCTTTGCGTTGTCTGTCACACTGCTGATTGTGGCGCCGTTGACATTACTT
ATCACCAGTATCATTCTTTCGAGGGCTGATAAGATGTATCTCTTCCGCTCATCGGTGTATTCCGAGATCAACGAC
GACAATATCCCGTTGCGTGGTCTGCGTGGTTTCTTCCGGTTCCCGTTTTTGCTCTTAATTCCTACAGCGGTGACT
GTCGGCTTGGCTTATATGGTTACAAAAGTCAACCCTTTTATTGCCCATAGCAGCTCATACGCCGTATGGAGTATG
ATGATCTCAGCTTGGATATTCTTAGCTTGGTTTGTATCTCGCATCGCAGACTTTGCACGCCCATCAGCTTTTCAT
CGAGTCTATACCTGGACTTGGATGTTTGTTCTTACCTGGTCTCTCATGGTAGTTGGCACCGTTTATGAACACGAG
GAAGGGCTCGCTGGTGGCTATTTCATGTTCTTTTACTTTGCCGGTACCTTCTTGGCTACATGGATCTCCTATTTG
GAGTTGTTCTCTCTGCCAACCAAGTCAGAATACGCTGCTAGATTATTTGAATCACGACGGCCTAGTACTCAGGGA
AGCCGGCTTGCTACGTCAGGCGATGAGGACCAGGACGATGATACTGAAGAGGACTTGACTGAATCAACATCGCTC
TTGCATGGCCGGCACCGCCCCACCTTTGCCAACTACGTCCGCGTTGGGGTAGACCGCGGATCTCATGAACAGGAC
GAAGAGGATGAAGAGAAAGATCCAAACGTGTATGAGGACGAGCAGGGGTGGAGTGGCGTGTTGCCGCGATGGACG
TGGCTGTTACAGCTGCTTATCACAGCTCCCGTGATTCTCATGCTGATCGTGCCGCTGGCTCTTCTGATTACCAGC
GCCCTCAGCCAAACTGGTCAGGATGGTAACCCCCAGCTGATTGTTTATCTCTTTATTTCCAGTCTTACCGTACTT
TTATTTGCACCTATTCTGCCATTTATCCACCGTTACACATACCACCTGCCTATCTTCTTACTCTTTGTTTTCATC
GGAACCTTGATCTACAACCTTGTCGCCTTCCCGTTCGCAGACTCCAATCGCCTGAAACTGTTCTTCCTGCAGGAG
GTCGACCTCGACAATGGGATGTCTACTGCTTCGCTGACTGGCATGCCTCCATTTGTCAAGGAAGTTACCTACGGG
CTCCCCAGCGCAGCAGGCCAAAATGAGGCCTGTGATTGGATTTTCCGAGGCAGCAACCGAGTTCAGCGATGCTCC
TGGAATGCACCAATACCACATGTTGTCCCCAGTCCTGAATCTCTATCGCTTCCAAACGAGGGTGCCGACTCTCTA
CTCGAGGCTTCCGAGCTGTCGCCGGACTGGATTTCCTTCAACATTTCCCACCCTCAATCGGACAGTTCATCTGTT
CGCTTTGAAGTATCAGGCCAAAACACGCGTAACTGCCGTATCAACATGGACGGCAATTATATCACAGACTTTAGT
GTGGTTGGCTCCTCCGCTCCAGACCAACGCTTCATAAATCCGTCCCCAGATGGTCTGAGCCGGATCCAACTGTGG
AGTCGTACATGGGACAACAAGTGGACTGTTGATGTCGATTTCTCAAAGCATGAGTCGTCCGAGGCCGATGGCAAT
TCCTCCATCACGGGCCGCATTACATGTCTATGGAGCGACAATAACCGAATCGGCCTCATCCCCGCTCTCGACGAG
GTAAGACAGTTCAGTCCGGCGTGGGTGGCTGTGACCAAGTTCTCTGATGGGTTGATTGAGGGGTCTCGAGCATTC
GAGATTAAGCGTTCGAGCCTCGGGACTTTGAGGTCTTGA
Transcript >Pro_DTO377G3_2|g2975.t1
ATGGCTACCCAGAAGGCCAGAAATCCTCTGGCATTTACGCCGTGGCCAGTAACAATCATCACCACGGTCGTATAC
CTCGCCTTGATTATCCCATTGCTGGTGATCCACCACATTGTCCCGCCCGCGCCCCAAACAAGCCCCAACGGCCTT
AACCTCACAGAGGCATGGCAAGATCTCCAAAGCCTGACAACAGGCTTTCACCCCTACAATTCGCACCAGAATGAC
GTGGTCCGCTCGTGGTTGCTCGAACGCATCGACGCGATCAAGCAGTCCGCCGCATCCACCGAGGAATACCGCGAC
GCGAAGGAAGAGAAGCCCGATGTTTTTGTTTTCGACGATCTGGTATCTAACCTGACTTTCATCGATAAAAGCGTC
GGTGTTTACTTTGAAGGCACCAATATCTTGGTCTACATTCGCGGCTCGGAAGATAGTAAGCAGAATTGGTGGGAG
ACTCCCGGACGAGTGCCCGTTGGCAAGGGAGGAGTACTTGTCAACGCGCACTACGATAGCGTTTCGACCGGGTAC
GGAGCGACAGACGATGGAGTTGGTGTCGTAACGTGCCTGCAGCTGGTGAAATACTTCCTGACGCCGGGCCATGCG
CCGCGCCGCGGGTTGGTGGTTCTTTTCAACAATGGCGAGGAGGACTATCTGAACGGCGCACGCGCGTACAGTCAG
CATCCGATGGCGCTATTTGCACACACATTCCTGAACCTGGAAGGTGCGGGTGCTGGAGGGCGTGCTACATTATTC
CGCAGCTCGGATACGGAGGTCACCCAGGCGTATGCGAAATCACAGCACCCATTCGGCTCAGTGTTGAGTGCCAAC
GGGTTCGAAAAGGGTTTGATTGGCAGCCAGACGGATTACATCGTCCTGGAAGGTATCTTGGGCCTGCGCGGTTTG
GATGTCGCTTTCTTTGAACCAAGAGCTCGTTATCATACCGATCAGGATGATGCTCGACACACTAATATCGACTCG
CTTTGGCACATGCTCTCTACTGCTGTTGCTACGACGGAGGAGCTTTTGTCTGACGCTACTGATCGATTCGACGGA
CATCTCCGCGACGATGGAAATGTGCCTAGCGGCTCAGGTACCCGGGCTGTTTGGTTCGATCTGTTTGGGAGTGCT
TTTGCCATCTTCCGTCTGCACACACTCTTTGCGTTGTCTGTCACACTGCTGATTGTGGCGCCGTTGACATTACTT
ATCACCAGTATCATTCTTTCGAGGGCTGATAAGATGTATCTCTTCCGCTCATCGGTGTATTCCGAGATCAACGAC
GACAATATCCCGTTGCGTGGTCTGCGTGGTTTCTTCCGGTTCCCGTTTTTGCTCTTAATTCCTACAGCGGTGACT
GTCGGCTTGGCTTATATGGTTACAAAAGTCAACCCTTTTATTGCCCATAGCAGCTCATACGCCGTATGGAGTATG
ATGATCTCAGCTTGGATATTCTTAGCTTGGTTTGTATCTCGCATCGCAGACTTTGCACGCCCATCAGCTTTTCAT
CGAGTCTATACCTGGACTTGGATGTTTGTTCTTACCTGGTCTCTCATGGTAGTTGGCACCGTTTATGAACACGAG
GAAGGGCTCGCTGGTGGCTATTTCATGTTCTTTTACTTTGCCGGTACCTTCTTGGCTACATGGATCTCCTATTTG
GAGTTGTTCTCTCTGCCAACCAAGTCAGAATACGCTGCTAGATTATTTGAATCACGACGGCCTAGTACTCAGGGA
AGCCGGCTTGCTACGTCAGGCGATGAGGACCAGGACGATGATACTGAAGAGGACTTGACTGAATCAACATCGCTC
TTGCATGGCCGGCACCGCCCCACCTTTGCCAACTACGTCCGCGTTGGGGTAGACCGCGGATCTCATGAACAGGAC
GAAGAGGATGAAGAGAAAGATCCAAACGTGTATGAGGACGAGCAGGGGTGGAGTGGCGTGTTGCCGCGATGGACG
TGGCTGTTACAGCTGCTTATCACAGCTCCCGTGATTCTCATGCTGATCGTGCCGCTGGCTCTTCTGATTACCAGC
GCCCTCAGCCAAACTGGTCAGGATGGTAACCCCCAGCTGATTGTTTATCTCTTTATTTCCAGTCTTACCGTACTT
TTATTTGCACCTATTCTGCCATTTATCCACCGTTACACATACCACCTGCCTATCTTCTTACTCTTTGTTTTCATC
GGAACCTTGATCTACAACCTTGTCGCCTTCCCGTTCGCAGACTCCAATCGCCTGAAACTGTTCTTCCTGCAGGAG
GTCGACCTCGACAATGGGATGTCTACTGCTTCGCTGACTGGCATGCCTCCATTTGTCAAGGAAGTTACCTACGGG
CTCCCCAGCGCAGCAGGCCAAAATGAGGCCTGTGATTGGATTTTCCGAGGCAGCAACCGAGTTCAGCGATGCTCC
TGGAATGCACCAATACCACATGTTGTCCCCAGTCCTGAATCTCTATCGCTTCCAAACGAGGGTGCCGACTCTCTA
CTCGAGGCTTCCGAGCTGTCGCCGGACTGGATTTCCTTCAACATTTCCCACCCTCAATCGGACAGTTCATCTGTT
CGCTTTGAAGTATCAGGCCAAAACACGCGTAACTGCCGTATCAACATGGACGGCAATTATATCACAGACTTTAGT
GTGGTTGGCTCCTCCGCTCCAGACCAACGCTTCATAAATCCGTCCCCAGATGGTCTGAGCCGGATCCAACTGTGG
AGTCGTACATGGGACAACAAGTGGACTGTTGATGTCGATTTCTCAAAGCATGAGTCGTCCGAGGCCGATGGCAAT
TCCTCCATCACGGGCCGCATTACATGTCTATGGAGCGACAATAACCGAATCGGCCTCATCCCCGCTCTCGACGAG
GTAAGACAGTTCAGTCCGGCGTGGGTGGCTGTGACCAAGTTCTCTGATGGGTTGATTGAGGGGTCTCGAGCATTC
GAGATTAAGCGTTCGAGCCTCGGGACTTTGAGGTCTTGA
Gene >Pro_DTO377G3_2|g2975.t1
ATGGCTACCCAGAAGGCCAGAAATCCTCTGGCATTTACGCCGTGGCCAGTAACAATCATCACCACGGTCGTATAC
CTCGCCTTGATTATCCCATTGCTGGTGATCCACCACATTGTCCCGCCCGCGCCCCAAACAAGCCCCAACGGCCTT
AACCTCACAGAGGCATGGCAAGATCTCCAAAGCCTGACAACAGGCTTTCACCCCTACAATTCGCACCAGAATGAC
GTGGTCCGCTCGTGGTTGCTCGAACGCATCGACGCGATCAAGCAGTCCGCCGCATCCACCGAGGAATACCGCGAC
GCGAAGGAAGAGAAGCCCGATGTTTTTGTTTTCGACGATCTGGTATCTAACCTGACTTTCATCGATAAAAGCGTC
GGTGTTTACTTTGAAGGCACCAATATCTTGGTCTACATTCGCGGCTCGGAAGATAGTAAGCAGAATTGGTGGGAG
ACTCCCGGACGAGTGCCCGTTGGCAAGGGAGGAGTACTTGTCAACGCGCACTACGATAGCGTTTCGACCGGGTAC
GGAGCGACAGACGATGGAGTTGGTGTCGTAACGTGCCTGCAGCTGGTGAAATACTTCCTGACGCCGGGCCATGCG
CCGCGCCGCGGGTTGGTGGTTCTTTTCAACAATGGCGAGGAGGACTATCTGAACGGCGCACGCGCGTACAGTCAG
CATCCGATGGCGCTATTTGCACACACATTCCTGAACCTGGAAGGTGCGGGTGCTGGAGGGCGTGCTACATTATTC
CGCAGCTCGGATACGGAGGTCACCCAGGCGTATGCGAAATCACAGCACCCATTCGGCTCAGTGTTGAGTGCCAAC
GGGTTCGAAAAGGGTTTGATTGGCAGCCAGACGGATTACATCGTCCTGGAAGGTATCTTGGGCCTGCGCGGTTTG
GATGTCGCTTTCTTTGAACCAAGAGCTCGTTATCATACCGATCAGGATGATGCTCGACACACTAATATCGACTCG
CTTTGGCACATGCTCTCTACTGCTGTTGCTACGACGGAGGAGCTTTTGTCTGACGCTACTGATCGATTCGACGGA
CATCTCCGCGACGATGGAAATGTGCCTAGCGGCTCAGGTACCCGGGCTGTTTGGTTCGATCTGTTTGGGAGTGCT
TTTGCCATCTTCCGTCTGCACACACTCTTTGCGTTGTCTGTCACACTGCTGATTGTGGCGCCGTTGACATTACTT
ATCACCAGTATCATTCTTTCGAGGGCTGATAAGATGTATCTCTTCCGCTCATCGGTGTATTCCGAGATCAACGAC
GACAATATCCCGTTGCGTGGTCTGCGTGGTTTCTTCCGGTTCCCGTTTTTGCTCTTAATTCCTACAGCGGTGACT
GTCGGCTTGGCTTATATGGTTACAAAAGTCAACCCTTTTATTGCCCATAGCAGCTCATACGCCGTATGGAGTATG
ATGATCTCAGCTTGGATATTCTTAGCTTGGTTTGTATCTCGCATCGCAGACTTTGCACGCCCATCAGCTTTTCAT
CGAGTCTATACCTGGACTTGGATGTTTGTTCTTACCTGGTCTCTCATGGTAGTTGGCACCGTTTATGAACACGAG
GAAGGGCTCGCTGGTGGCTATTTCATGTTCTTTTACTTTGCCGGTACCTTCTTGGCTACATGGATCTCCTATTTG
GAGTTGTTCTCTCTGCCAACCAAGTCAGAATACGCTGCTAGATTATTTGAATCACGACGGCCTAGTACTCAGGGA
AGCCGGCTTGCTACGTCAGGCGATGAGGACCAGGACGATGATACTGAAGAGGACTTGACTGAATCAACATCGCTC
TTGCATGGCCGGCACCGCCCCACCTTTGCCAACTACGTCCGCGTTGGGGTAGACCGCGGATCTCATGAACAGGAC
GAAGAGGATGAAGAGAAAGATCCAAACGTGTATGAGGACGAGCAGGGGTGGAGTGGCGTGTTGCCGCGATGGACG
TGGCTGTTACAGCTGCTTATCACAGCTCCCGTGATTCTCATGCTGATCGTGCCGCTGGCTCTTCTGATTACCAGC
GCCCTCAGCCAAACTGGTCAGGATGGTAACCCCCAGCTGATTGTTTATCTCTTTATTTCCAGTCTTACCGTACTT
TTATTTGCACCTATTCTGCCATTTATCCACCGTTACACATACCACCTGCCTATCTTCTTACTCTTTGTTTTCATC
GGAACCTTGATCTACAACCTTGTCGCCTTCCCGTTCGCAGACTCCAATCGCCTGAAACTGTTCTTCCTGCAGGAG
GTCGACCTCGACAATGGGATGTCTACTGCTTCGCTGACTGGCATGCCTCCATTTGTCAAGGAAGTTACCTACGGG
CTCCCCAGCGCAGCAGGCCAAAATGAGGCCTGTGATTGGATTTTCCGAGGCAGCAACCGAGTTCAGCGATGCTCC
TGGAATGCACCAATACCACATGTTGTCCCCAGTCCTGAATCTCTATCGCTTCCAAACGAGGGTGCCGACTCTCTA
CTCGAGGCTTCCGAGCTGTCGCCGGACTGGATTTCCTTCAACATTTCCCACCCTCAATCGGACAGTTCATCTGTT
CGCTTTGAAGTATCAGGCCAAAACACGCGTAACTGCCGTATCAACATGGACGGCAATTATATCACAGACTTTAGT
GTGGTTGGCTCCTCCGCTCCAGACCAACGCTTCATAAATCCGTCCCCAGATGGTCTGAGCCGGATCCAACTGTGG
AGTCGTACATGGGACAACAAGTGGACTGTTGATGTCGATTTCTCAAAGCATGAGTCGTCCGAGGCCGATGGCAAT
TCCTCCATCACGGGCCGCATTACATGTCTATGGAGCGACAATAACCGAATCGGCCTCATCCCCGCTCTCGACGAG
GTAAGACAGTTCAGTCCGGCGTGGGTGGCTGTGACCAAGTTCTCTGATGGGTTGATTGAGGGGTCTCGAGCATTC
GAGATTAAGCGTTCGAGCCTCGGGACTTTGAGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail