Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2958.t1
Gene name
Locationscaffold_04:320537..322709
Strand-
Gene length (bp)2172
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00515 TPR_1 Tetratricopeptide repeat 8.7E-09 470 503
PF07719 TPR_2 Tetratricopeptide repeat 2.5E-06 470 502
PF00226 DnaJ DnaJ domain 1.6E-25 558 620
PF13432 TPR_16 Tetratricopeptide repeat 7.9E-03 208 261
PF13432 TPR_16 Tetratricopeptide repeat 2.2E-08 438 502
PF13414 TPR_11 TPR repeat 7.8E-09 208 246
PF13181 TPR_8 Tetratricopeptide repeat 4.6E-02 212 233
PF13181 TPR_8 Tetratricopeptide repeat 2.0E-05 470 501
PF13174 TPR_6 Tetratricopeptide repeat 4.6E-02 387 418

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2958.t1
MVQLAHIFKKDKDKDKTEKNKPDLRPSRSSFSASRTSPSPKSPSKSPTKPPTKSPSKSSSPTKSPKPAKQSYFSL
SRSSSNSGPTANFKFARSSRDQDIHPLNLPPDELRRRLSAMAASNEEQQNFMDIDPKEPQIDAVKDDVKNDALKT
DAAKIDAVKTDAVKTETAKTDAVKKDAVKETEERSPTPPPHQSNISSADEADSFKLAGNKFFKDGNYRRAIDEYN
KAIEINPNSPVYLSNRAAAYMSAKQFPNALQDVQRASELDHGNPKIMHRWAKILTNLGRPAEALEVLSRIQPPAT
ATDRAAAEKMLRFVTQAERTIAEDRGVSMVIYCLDQARQGLGQGVREPRKWTLMAAEAHLRLNNINSLGRAQDIA
INLLRENSQDPDAMMIRARAFYALGETEQAQKVLKMCLGLDPDMKQAIKLLRIVQKLSRTKEEGNTAYKARDYRR
AIDLWAQALEVDPSNKDMNAKILGNRAQAYINLKEYDSAIQDCTEALRLDPGYTKAMKYRAKAQGKAGNWEEAIR
DYKSVAENNPGESGIAEEIREAEFELKKSQRKDYYKILGVESDASEQEIKKAYRKLAILYHPDKNRDGAAGDEKF
KEIGEAYENLIDPQKRAAFDNGDDLRDPADMYGGGGFPGGGGFGGFGGGVHHIDPDVLRNMMNGGGSFGGHGGFS
F*
Coding >Pro_DTO377G3_2|g2958.t1
ATGGTCCAACTCGCCCACATCTTCAAAAAGGACAAGGATAAGGATAAGACCGAGAAGAACAAACCTGATCTACGT
CCGTCTCGATCTTCCTTCTCCGCTTCGCGCACATCTCCATCTCCGAAGTCGCCCTCCAAATCCCCAACCAAGCCA
CCTACCAAATCTCCCTCCAAATCATCGTCCCCCACCAAATCTCCCAAACCTGCCAAACAATCATACTTTTCTCTC
AGTCGGTCATCCTCCAATTCCGGACCGACCGCCAATTTCAAGTTTGCCCGGTCTTCGCGTGACCAGGACATACAT
CCACTCAATCTCCCACCTGACGAGCTACGTCGTCGATTGTCCGCCATGGCAGCATCCAACGAAGAGCAGCAGAAC
TTCATGGATATTGATCCCAAGGAACCCCAGATTGATGCTGTGAAGGATGATGTCAAGAATGATGCCCTGAAGACT
GATGCTGCGAAGATTGATGCGGTGAAGACTGATGCGGTGAAGACTGAGACGGCGAAGACCGATGCTGTGAAGAAA
GATGCCGTGAAGGAAACTGAGGAGCGGAGTCCGACTCCGCCACCGCACCAGTCGAATATATCTTCTGCCGACGAG
GCCGACTCCTTCAAGTTGGCCGGAAACAAGTTCTTCAAGGATGGCAATTATCGACGAGCTATCGATGAATACAAC
AAGGCCATCGAGATCAATCCCAACTCACCAGTCTATCTCTCTAACCGAGCGGCGGCTTACATGTCCGCCAAACAA
TTCCCGAATGCGTTGCAGGATGTTCAACGTGCCAGCGAGCTCGATCATGGCAACCCGAAGATCATGCACCGATGG
GCTAAGATTCTGACGAATTTGGGTCGTCCTGCAGAGGCCCTAGAGGTGCTGTCACGTATCCAGCCACCAGCCACT
GCCACCGACCGGGCAGCCGCAGAGAAGATGCTACGCTTCGTCACGCAAGCCGAGCGGACAATAGCGGAAGACCGC
GGTGTGTCGATGGTGATCTACTGTCTAGACCAGGCACGCCAAGGGCTCGGACAAGGTGTCCGGGAGCCCCGCAAG
TGGACGCTTATGGCCGCCGAGGCTCATCTGAGGCTGAACAACATCAACTCGCTAGGCAGAGCACAGGACATTGCA
ATCAACTTGCTGCGCGAGAACAGCCAGGACCCGGATGCGATGATGATCCGTGCCCGCGCCTTCTATGCCCTCGGT
GAAACCGAGCAGGCACAGAAGGTTCTGAAGATGTGCCTCGGGCTGGACCCGGACATGAAGCAGGCCATCAAGCTA
CTGCGCATTGTGCAGAAGTTGTCTCGCACAAAAGAGGAAGGAAACACCGCTTACAAGGCCAGGGACTATCGCCGT
GCTATCGATCTTTGGGCACAGGCTCTCGAGGTTGACCCCTCCAACAAGGATATGAATGCCAAGATTCTGGGTAAC
CGTGCCCAGGCTTATATCAACTTGAAGGAGTATGATTCTGCCATTCAGGACTGTACCGAAGCGCTCCGTCTCGAC
CCCGGGTATACGAAGGCTATGAAGTACCGTGCCAAGGCCCAGGGCAAGGCCGGTAACTGGGAGGAGGCTATTCGT
GACTATAAGAGCGTTGCTGAGAACAACCCCGGCGAGAGCGGCATTGCGGAGGAGATCCGCGAAGCTGAATTCGAG
CTGAAGAAGTCTCAACGCAAAGACTACTATAAGATTTTGGGAGTCGAGAGTGATGCCAGCGAACAGGAAATCAAG
AAGGCCTACCGCAAGTTGGCTATTCTATATCACCCAGATAAGAACCGTGACGGTGCAGCCGGCGATGAGAAGTTC
AAGGAAATTGGTGAAGCCTATGAGAATTTGATTGATCCTCAGAAACGTGCTGCTTTCGATAACGGAGACGATCTG
AGGGACCCAGCTGACATGTATGGCGGCGGTGGTTTCCCCGGTGGTGGAGGTTTCGGCGGCTTCGGTGGCGGCGTT
CACCACATCGATCCCGATGTTCTTCGAAACATGATGAACGGCGGCGGCTCCTTTGGTGGCCACGGCGGCTTTTCA
TTCTAG
Transcript >Pro_DTO377G3_2|g2958.t1
ATGGTCCAACTCGCCCACATCTTCAAAAAGGACAAGGATAAGGATAAGACCGAGAAGAACAAACCTGATCTACGT
CCGTCTCGATCTTCCTTCTCCGCTTCGCGCACATCTCCATCTCCGAAGTCGCCCTCCAAATCCCCAACCAAGCCA
CCTACCAAATCTCCCTCCAAATCATCGTCCCCCACCAAATCTCCCAAACCTGCCAAACAATCATACTTTTCTCTC
AGTCGGTCATCCTCCAATTCCGGACCGACCGCCAATTTCAAGTTTGCCCGGTCTTCGCGTGACCAGGACATACAT
CCACTCAATCTCCCACCTGACGAGCTACGTCGTCGATTGTCCGCCATGGCAGCATCCAACGAAGAGCAGCAGAAC
TTCATGGATATTGATCCCAAGGAACCCCAGATTGATGCTGTGAAGGATGATGTCAAGAATGATGCCCTGAAGACT
GATGCTGCGAAGATTGATGCGGTGAAGACTGATGCGGTGAAGACTGAGACGGCGAAGACCGATGCTGTGAAGAAA
GATGCCGTGAAGGAAACTGAGGAGCGGAGTCCGACTCCGCCACCGCACCAGTCGAATATATCTTCTGCCGACGAG
GCCGACTCCTTCAAGTTGGCCGGAAACAAGTTCTTCAAGGATGGCAATTATCGACGAGCTATCGATGAATACAAC
AAGGCCATCGAGATCAATCCCAACTCACCAGTCTATCTCTCTAACCGAGCGGCGGCTTACATGTCCGCCAAACAA
TTCCCGAATGCGTTGCAGGATGTTCAACGTGCCAGCGAGCTCGATCATGGCAACCCGAAGATCATGCACCGATGG
GCTAAGATTCTGACGAATTTGGGTCGTCCTGCAGAGGCCCTAGAGGTGCTGTCACGTATCCAGCCACCAGCCACT
GCCACCGACCGGGCAGCCGCAGAGAAGATGCTACGCTTCGTCACGCAAGCCGAGCGGACAATAGCGGAAGACCGC
GGTGTGTCGATGGTGATCTACTGTCTAGACCAGGCACGCCAAGGGCTCGGACAAGGTGTCCGGGAGCCCCGCAAG
TGGACGCTTATGGCCGCCGAGGCTCATCTGAGGCTGAACAACATCAACTCGCTAGGCAGAGCACAGGACATTGCA
ATCAACTTGCTGCGCGAGAACAGCCAGGACCCGGATGCGATGATGATCCGTGCCCGCGCCTTCTATGCCCTCGGT
GAAACCGAGCAGGCACAGAAGGTTCTGAAGATGTGCCTCGGGCTGGACCCGGACATGAAGCAGGCCATCAAGCTA
CTGCGCATTGTGCAGAAGTTGTCTCGCACAAAAGAGGAAGGAAACACCGCTTACAAGGCCAGGGACTATCGCCGT
GCTATCGATCTTTGGGCACAGGCTCTCGAGGTTGACCCCTCCAACAAGGATATGAATGCCAAGATTCTGGGTAAC
CGTGCCCAGGCTTATATCAACTTGAAGGAGTATGATTCTGCCATTCAGGACTGTACCGAAGCGCTCCGTCTCGAC
CCCGGGTATACGAAGGCTATGAAGTACCGTGCCAAGGCCCAGGGCAAGGCCGGTAACTGGGAGGAGGCTATTCGT
GACTATAAGAGCGTTGCTGAGAACAACCCCGGCGAGAGCGGCATTGCGGAGGAGATCCGCGAAGCTGAATTCGAG
CTGAAGAAGTCTCAACGCAAAGACTACTATAAGATTTTGGGAGTCGAGAGTGATGCCAGCGAACAGGAAATCAAG
AAGGCCTACCGCAAGTTGGCTATTCTATATCACCCAGATAAGAACCGTGACGGTGCAGCCGGCGATGAGAAGTTC
AAGGAAATTGGTGAAGCCTATGAGAATTTGATTGATCCTCAGAAACGTGCTGCTTTCGATAACGGAGACGATCTG
AGGGACCCAGCTGACATGTATGGCGGCGGTGGTTTCCCCGGTGGTGGAGGTTTCGGCGGCTTCGGTGGCGGCGTT
CACCACATCGATCCCGATGTTCTTCGAAACATGATGAACGGCGGCGGCTCCTTTGGTGGCCACGGCGGCTTTTCA
TTCTAG
Gene >Pro_DTO377G3_2|g2958.t1
ATGGTCCAACTCGCCCACATCTTCAAAAAGGACAAGGATAAGGATAAGACCGAGAAGAACAAACCTGATCTACGT
CCGTCTCGATCTTCCTTCTCCGCTTCGCGCACATCTCCATCTCCGAAGTCGCCCTCCAAATCCCCAACCAAGCCA
CCTACCAAATCTCCCTCCAAATCATCGTCCCCCACCAAATCTCCCAAACCTGCCAAACAATCATACTTTTCTCTC
AGTCGGTCATCCTCCAATTCCGGACCGACCGCCAATTTCAAGTTTGCCCGGTCTTCGCGTGACCAGGACATACAT
CCACTCAATCTCCCACCTGACGAGCTACGTCGTCGATTGTCCGCCATGGCAGCATCCAACGAAGAGCAGCAGAAC
TTCATGGATATTGATCCCAAGGAACCCCAGATTGATGCTGTGAAGGATGATGTCAAGAATGATGCCCTGAAGACT
GATGCTGCGAAGATTGATGCGGTGAAGACTGATGCGGTGAAGACTGAGACGGCGAAGACCGATGCTGTGAAGAAA
GATGCCGTGAAGGAAACTGAGGAGCGGAGTCCGACTCCGCCACCGCACCAGTCGAATATATCTTCTGCCGACGAG
GCCGACTCCTTCAAGTTGGCCGGAAACAAGTTCTTCAAGGATGGCAATTATCGACGAGCTATCGATGAATACAAC
AAGGGTATGCATTTTCTCTATCCCACAGGGACACCGTGTCTCATGACTTAGCCTTGAATGAGCGGGGTCGCTGAT
GATTTTCGTGTACTGTAGCCATCGAGATCAATCCCAACTCACCAGTCTATCTCTCTAACCGAGCGGCGGCTTACA
TGTCCGCCAAACAATTCCCGAATGCGTTGCAGGATGTTCAACGTGCCAGCGAGCTCGATCATGGCAACCCGAAGA
TCATGCACCGATGGGCTAAGATTCTGACGAATTTGGGTCGTCCTGCAGAGGCCCTAGAGGTGCTGTCACGTATCC
AGCCACCAGCCACTGCCACCGACCGGGCAGCCGCAGAGAAGATGCTACGCTTCGTCACGCAAGCCGAGCGGACAA
TAGCGGAAGACCGCGGTGTGTCGATGGTGATCTACTGTCTAGACCAGGCACGCCAAGGGCTCGGACAAGGTGTCC
GGGAGCCCCGCAAGTGGACGCTTATGGCCGCCGAGGCTCATCTGAGGCTGAACAACATCAACTCGCTAGGCAGAG
CACAGGACATTGCAATCAACTTGCTGCGCGAGAACAGCCAGGACCCGGATGCGATGATGATCCGTGCCCGCGCCT
TCTATGCCCTCGGTGAAACCGAGCAGGCACAGAAGGTTCTGAAGATGTGCCTCGGGCTGGACCCGGACATGAAGC
AGGCCATCAAGCTACTGCGCATTGTGCAGAAGTTGTCTCGCACAAAAGAGGAAGGAAACACCGCTTACAAGGCCA
GGGACTATCGCCGTGCTATCGATCTTTGGGCACAGGCTCTCGAGGTTGACCCCTCCAACAAGGATATGAATGCCA
AGATTCTGGGTAACCGTGCCCAGGCTTATATCAACTTGAAGGAGTATGATTCTGCCATTCAGGACTGTACCGAAG
CGCTCCGTCTCGACCCCGGGTATACGAAGGCTATGAAGTACCGTGCCAAGGCCCAGGGCAAGGCCGGTAACTGGG
AGGAGGCTATTCGTGACTATAAGAGCGTTGCTGAGAACAACCCCGGCGAGAGCGGCATTGCGGAGGAGATCCGCG
AAGCTGAATTCGAGCTGAAGAAGTCTCAACGCAAAGACTACTATAAGATTTTGGGAGTCGAGAGTGATGCCAGCG
AACAGGAAATCAAGAAGGCCTACCGCAAGTTGGCTATTCTATATCACCCAGATAAGAACCGTGACGGTGCAGCCG
GCGATGAGAAGTTCAAGGAAATTGGTGAAGCCTATGAGAATTTGATTGATCCTCAGTAAGTCCGCCACAACTTTC
AACCCCATTCGACACAATGCTAACCTCATTAGGAAACGTGCTGCTTTCGATAACGGAGACGATCTGAGGGACCCA
GCTGACATGTATGGCGGCGGTGGTTTCCCCGGTGGTGGAGGTTTCGGCGGCTTCGGTGGCGGCGTTCACCACATC
GATCCCGATGTTCTTCGAAACATGATGAACGGCGGCGGCTCCTTTGGTGGCCACGGCGGCTTTTCATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail