Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2942.t1
Gene name
Locationscaffold_04:280889..281666
Strand+
Gene length (bp)777
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 7.4E-09 11 206
PF13242 Hydrolase_like HAD-hyrolase-like 2.1E-06 160 232

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 95.09 54.95 135.22
5d_25C Five days - 25 degrees Celsius 194.79 118.45 271.14
7d_25C Seven days - 25 degrees Celsius 252.77 153.74 351.80
10d_25C Ten days - 25 degrees Celsius 397.03 240.84 553.22
7d_15C Seven days - 15 degrees Celsius 180.29 105.92 254.65
7d_30C Seven days - 30 degrees Celsius 180.70 108.36 253.04

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.003625 yes
3d_25C 7d_30C 0.002761 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.257627 no
5d_25C 7d_15C 0.806450 no
5d_25C 7d_30C 0.808464 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.137528 no
7d_25C 7d_30C 0.134572 no
7d_25C 10d_25C 0.031528 yes
7d_15C 7d_30C 0.995455 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2942.t1
MTANTANTVVAFDLYGTLLSTQSIAKHLEKHYDNAKAQSISALWRRYQLEYTWRLNSMGRYEDFSVITRNSLLHA
LADNNEQLSNDNIERLMQAYDSLSTFSDVNPALINIAADPTIQAVIFSNGTKTMVTNSVLRSKDLSPHASVCQEI
VTIDEVQQYKPSKATYEHLAKQIGQDPSQMSKLWLVSGNPFDIVGARATGMQAIWVDRVGTGWKDAMAPDLQPTA
IVHSLEQIVNEIHSRRL*
Coding >Pro_DTO377G3_2|g2942.t1
ATGACAGCTAATACAGCCAATACAGTTGTCGCTTTTGATTTATATGGCACTTTACTCTCAACTCAATCGATCGCC
AAACACTTAGAGAAACATTATGACAATGCCAAGGCGCAGTCTATCTCCGCGCTCTGGAGGCGGTATCAACTGGAG
TACACATGGAGATTGAACAGCATGGGCCGCTATGAAGACTTCTCAGTCATCACTCGTAATTCCCTACTGCACGCG
CTAGCCGATAACAACGAGCAGCTGAGCAACGACAACATCGAACGCTTGATGCAAGCTTACGATAGTCTCTCTACA
TTTTCTGACGTGAATCCAGCTTTGATCAACATCGCTGCAGACCCAACCATCCAAGCTGTTATATTCTCCAATGGG
ACGAAAACCATGGTAACCAACTCGGTGTTGCGATCAAAGGACCTTTCGCCGCACGCGAGTGTCTGTCAAGAAATC
GTCACCATAGACGAAGTCCAGCAATATAAGCCATCAAAGGCAACCTACGAGCACCTAGCGAAGCAGATAGGCCAA
GATCCGTCGCAGATGAGCAAACTTTGGCTGGTTAGCGGCAACCCTTTCGACATTGTCGGGGCGCGCGCTACAGGC
ATGCAGGCTATATGGGTTGATCGTGTTGGTACAGGATGGAAGGACGCCATGGCTCCAGATCTACAACCAACGGCC
ATTGTACACAGTCTGGAGCAAATTGTGAACGAGATTCATAGCCGTCGCCTTTAA
Transcript >Pro_DTO377G3_2|g2942.t1
ATGACAGCTAATACAGCCAATACAGTTGTCGCTTTTGATTTATATGGCACTTTACTCTCAACTCAATCGATCGCC
AAACACTTAGAGAAACATTATGACAATGCCAAGGCGCAGTCTATCTCCGCGCTCTGGAGGCGGTATCAACTGGAG
TACACATGGAGATTGAACAGCATGGGCCGCTATGAAGACTTCTCAGTCATCACTCGTAATTCCCTACTGCACGCG
CTAGCCGATAACAACGAGCAGCTGAGCAACGACAACATCGAACGCTTGATGCAAGCTTACGATAGTCTCTCTACA
TTTTCTGACGTGAATCCAGCTTTGATCAACATCGCTGCAGACCCAACCATCCAAGCTGTTATATTCTCCAATGGG
ACGAAAACCATGGTAACCAACTCGGTGTTGCGATCAAAGGACCTTTCGCCGCACGCGAGTGTCTGTCAAGAAATC
GTCACCATAGACGAAGTCCAGCAATATAAGCCATCAAAGGCAACCTACGAGCACCTAGCGAAGCAGATAGGCCAA
GATCCGTCGCAGATGAGCAAACTTTGGCTGGTTAGCGGCAACCCTTTCGACATTGTCGGGGCGCGCGCTACAGGC
ATGCAGGCTATATGGGTTGATCGTGTTGGTACAGGATGGAAGGACGCCATGGCTCCAGATCTACAACCAACGGCC
ATTGTACACAGTCTGGAGCAAATTGTGAACGAGATTCATAGCCGTCGCCTTTAA
Gene >Pro_DTO377G3_2|g2942.t1
ATGACAGCTAATACAGCCAATACAGTTGTCGCTTTTGATTTATATGGCACTTTACTCTCAACTCAATCGATCGCC
AAACACTTAGAGAAACATTATGACAATGCCAAGGCGCAGTCTATCTCCGCGCTCTGGAGGCGGTATCAACTGGAG
TACACATGGAGATTGAACAGCATGGGCAAGCAACACTTCCAGGCTTGGCGCTCAAATTATTGACGATCAAAAGGC
CGCTATGAAGACTTCTCAGTCATCACTCGTAATTCCCTACTGCACGCGCTAGCCGATAACAACGAGCAGCTGAGC
AACGACAACATCGAACGCTTGATGCAAGCTTACGATAGTCTCTCTACATTTTCTGACGTGAATCCAGCTTTGATC
AACATCGCTGCAGACCCAACCATCCAAGCTGTTATATTCTCCAATGGGACGAAAACCATGGTAACCAACTCGGTG
TTGCGATCAAAGGACCTTTCGCCGCACGCGAGTGTCTGTCAAGAAATCGTCACCATAGACGAAGTCCAGCAATAT
AAGCCATCAAAGGCAACCTACGAGCACCTAGCGAAGCAGATAGGCCAAGATCCGTCGCAGATGAGCAAACTTTGG
CTGGTTAGCGGCAACCCTTTCGACATTGTCGGGGCGCGCGCTACAGGCATGCAGGCTATATGGGTTGATCGTGTT
GGTACAGGATGGAAGGACGCCATGGCTCCAGATCTACAACCAACGGCCATTGTACACAGTCTGGAGCAAATTGTG
AACGAGATTCATAGCCGTCGCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail