Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2918.t1
Gene name
Locationscaffold_04:222917..224186
Strand-
Gene length (bp)1269
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 3.8E-32 105 291
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 8.8E-23 110 270
PF08659 KR KR domain 4.5E-10 106 264

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 42 61 19
2 66 88 22
3 101 123 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 49.02 27.91 70.14
5d_25C Five days - 25 degrees Celsius 43.27 24.22 62.32
7d_25C Seven days - 25 degrees Celsius 36.39 19.57 53.22
10d_25C Ten days - 25 degrees Celsius 30.87 16.04 45.71
7d_15C Seven days - 15 degrees Celsius 38.92 21.34 56.51
7d_30C Seven days - 30 degrees Celsius 40.86 22.54 59.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.685483 no
3d_25C 7d_25C 0.260537 no
3d_25C 7d_15C 0.405968 no
3d_25C 7d_30C 0.536426 no
3d_25C 10d_25C 0.059343 no
5d_25C 7d_25C 0.567692 no
5d_25C 7d_15C 0.752350 no
5d_25C 7d_30C 0.876610 no
5d_25C 10d_25C 0.197390 no
7d_25C 7d_15C 0.857070 no
7d_25C 7d_30C 0.732787 no
7d_25C 10d_25C 0.604176 no
7d_15C 7d_30C 0.898950 no
7d_15C 10d_25C 0.426301 no
7d_30C 10d_25C 0.318540 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2918.t1
MSSSNPQVLKTTAKPPQTTPGSTNPHTSLLTIDILTSILSKSLLNPFIAWIFVLCLRAHVTPSTDPAWILAVSYA
TAMTVLFVVRIINQRAAYGAPRKVDFEHEVVVITGGASGLGLLIVQMYSMRGASVAVLDIKDVPEKGRDEVFGEG
VLYITCDVADRRALEVARERILQELGTPTIVINCAAARINGLSLLDLPADAFEKTIRTNLLAAFHLYQVFLPGII
AAKSGGTLVTVSSVLGQLSAAGLSDYAASKAGLSALHRTIEAEVRVNPLIKTLLVEVGQMSTPLFDWVRAPNHFF
APILEPVEVAREMVAAIDSGRGGVIRLPFYAKLVNWYAVLPATVQRVARYLSGIDAAVTQSRQTSGKTY*
Coding >Pro_DTO377G3_2|g2918.t1
ATGTCATCTTCAAATCCTCAAGTTCTAAAAACAACAGCCAAACCACCCCAGACAACTCCCGGCTCGACCAATCCA
CACACCAGCCTCCTGACAATCGACATCCTAACAAGCATCCTCTCCAAATCACTACTCAACCCTTTCATAGCCTGG
ATTTTCGTCCTCTGCCTACGCGCCCATGTAACCCCATCAACAGATCCAGCCTGGATCCTCGCTGTAAGCTATGCA
ACGGCCATGACAGTCCTCTTCGTCGTGCGAATTATCAACCAGCGCGCCGCCTACGGCGCCCCGCGAAAAGTCGAT
TTCGAGCATGAGGTCGTGGTCATCACTGGCGGGGCGAGTGGGCTAGGTCTGCTAATTGTGCAAATGTATAGCATG
CGCGGGGCGAGTGTCGCTGTGCTGGATATTAAAGATGTTCCGGAAAAAGGCCGCGATGAGGTCTTTGGGGAGGGC
GTTTTGTATATTACGTGTGACGTCGCGGATAGACGTGCTTTAGAAGTTGCGAGGGAGAGGATTTTGCAAGAGTTA
GGAACACCGACGATCGTTATCAACTGTGCCGCGGCCAGGATCAACGGTCTCTCGCTGCTTGATCTGCCAGCGGAC
GCATTCGAGAAGACAATCCGCACCAATCTCCTAGCGGCTTTCCATCTGTACCAAGTCTTCTTGCCTGGGATCATC
GCAGCAAAGAGTGGAGGAACTCTTGTCACAGTCAGCTCCGTGCTGGGCCAACTGAGTGCCGCGGGACTGTCAGAC
TACGCAGCGAGCAAAGCAGGACTTAGCGCGCTGCATCGGACGATAGAAGCGGAAGTTCGGGTTAACCCGTTGATC
AAGACATTGCTAGTGGAAGTTGGTCAGATGTCGACGCCGTTGTTCGACTGGGTGCGTGCGCCGAATCATTTCTTT
GCGCCAATCCTGGAACCCGTCGAAGTTGCCCGGGAGATGGTGGCAGCGATTGATAGCGGTCGAGGTGGTGTGATC
AGGTTGCCTTTTTATGCAAAGCTCGTGAATTGGTATGCCGTGCTACCCGCTACGGTGCAGCGGGTTGCGAGATAT
CTGAGTGGGATAGATGCTGCTGTTACGCAAAGCCGGCAGACATCTGGGAAGACATATTGA
Transcript >Pro_DTO377G3_2|g2918.t1
ATGTCATCTTCAAATCCTCAAGTTCTAAAAACAACAGCCAAACCACCCCAGACAACTCCCGGCTCGACCAATCCA
CACACCAGCCTCCTGACAATCGACATCCTAACAAGCATCCTCTCCAAATCACTACTCAACCCTTTCATAGCCTGG
ATTTTCGTCCTCTGCCTACGCGCCCATGTAACCCCATCAACAGATCCAGCCTGGATCCTCGCTGTAAGCTATGCA
ACGGCCATGACAGTCCTCTTCGTCGTGCGAATTATCAACCAGCGCGCCGCCTACGGCGCCCCGCGAAAAGTCGAT
TTCGAGCATGAGGTCGTGGTCATCACTGGCGGGGCGAGTGGGCTAGGTCTGCTAATTGTGCAAATGTATAGCATG
CGCGGGGCGAGTGTCGCTGTGCTGGATATTAAAGATGTTCCGGAAAAAGGCCGCGATGAGGTCTTTGGGGAGGGC
GTTTTGTATATTACGTGTGACGTCGCGGATAGACGTGCTTTAGAAGTTGCGAGGGAGAGGATTTTGCAAGAGTTA
GGAACACCGACGATCGTTATCAACTGTGCCGCGGCCAGGATCAACGGTCTCTCGCTGCTTGATCTGCCAGCGGAC
GCATTCGAGAAGACAATCCGCACCAATCTCCTAGCGGCTTTCCATCTGTACCAAGTCTTCTTGCCTGGGATCATC
GCAGCAAAGAGTGGAGGAACTCTTGTCACAGTCAGCTCCGTGCTGGGCCAACTGAGTGCCGCGGGACTGTCAGAC
TACGCAGCGAGCAAAGCAGGACTTAGCGCGCTGCATCGGACGATAGAAGCGGAAGTTCGGGTTAACCCGTTGATC
AAGACATTGCTAGTGGAAGTTGGTCAGATGTCGACGCCGTTGTTCGACTGGGTGCGTGCGCCGAATCATTTCTTT
GCGCCAATCCTGGAACCCGTCGAAGTTGCCCGGGAGATGGTGGCAGCGATTGATAGCGGTCGAGGTGGTGTGATC
AGGTTGCCTTTTTATGCAAAGCTCGTGAATTGGTATGCCGTGCTACCCGCTACGGTGCAGCGGGTTGCGAGATAT
CTGAGTGGGATAGATGCTGCTGTTACGCAAAGCCGGCAGACATCTGGGAAGACATATTGA
Gene >Pro_DTO377G3_2|g2918.t1
ATGTCATCTTCAAATCCTCAAGTTCTAAAAACAACAGCCAAACCACCCCAGACAACTCCCGGCTCGACCAATCCA
CACACCAGCCTCCTGACAATCGACATCCTAACAAGCATCCTCTCCAAATCACTACTCAACCCTTTCATAGCCTGG
ATTTTCGTCCTCTGCCTACGCGCCCATGTAACCCCATCAACAGATCCAGCCTGGATCCTCGCTGTAAGCTATGCA
ACGGCCATGACAGTCCTCTTCGTCGTGCGAATTATCAACCAGCGCGCCGCCTACGGCGCCCCGCGAAAAGTCGAT
TTCGAGCATGAGGTCGTGGTCATCACTGGCGGGGCGAGTGGGCTAGGTCTGCTAATTGTGCAAATGTATAGCATG
CGCGGGGCGAGTGTCGCTGTGCTGGATATTAAAGATGTTCCGGAAAAAGGCCGCGATGAGGTCTTTGGGGAGGGC
GTTTTGTATATTACGTGTGACGTCGCGGATAGACGTGCTTTAGAAGTTGCGAGGGAGAGGATTTTGCAAGAGGTA
GGTTTTGCTTTTTTACTTTTGTTTTCGTTGTGACCTTCGATCCCATATCATCCTACTATTACTGCGGTTCTAGTG
ATTTGAATATTTGGATAAGGTGTTTTCATAGCGCGTTATGGCTTGCTTCAATTGGGGTCTGATTCGCTAAAAATC
TTGCAGTTAGGAACACCGACGATCGTTATCAACTGTGCCGCGGCCAGGATCAACGGTCTCTCGCTGCTTGATCTG
CCAGCGGACGCATTCGAGAAGACAATCCGCACCAATCTCCTAGCGGCTTTCCATCTGTACCAAGTCTTCTTGCCT
GGGATCATCGCAGCAAAGAGTGGAGGAACTCTTGTCACAGTCAGCTCCGTGCTGGGCCAACTGAGTGCCGCGGGA
CTGTCAGACTACGCAGCGAGCAAAGCAGGACTTAGCGCGCTGCATCGGACGATAGAAGCGGAAGTTCGGGTTAAC
CCGTTGATCAAGACATTGCTAGTGGAAGTTGGTCAGATGTCGACGCCGTTGTTCGACTGGGTGCGTGCGCCGAAT
CATTTCTTTGCGCCAATCCTGGAACCCGTCGAAGTTGCCCGGGAGATGGTGGCAGCGATTGATAGCGGTCGAGGT
GGTGTGATCAGGTTGCCTTTTTATGCAAAGCTCGTGAATTGGTATGCCGTGCTACCCGCTACGGTGCAGCGGGTT
GCGAGATATCTGAGTGGGATAGATGCTGCTGTTACGCAAAGCCGGCAGACATCTGGGAAGACATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail