Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2908.t1
Gene name
Locationscaffold_04:197533..199038
Strand+
Gene length (bp)1505
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.1E-53 7 232
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 4.9E-33 333 440
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 8.9E-13 259 324

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032561 guanyl ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1069.85 561.43 1578.27
5d_25C Five days - 25 degrees Celsius 903.31 482.97 1323.65
7d_25C Seven days - 25 degrees Celsius 960.04 504.30 1415.78
10d_25C Ten days - 25 degrees Celsius 826.36 445.26 1207.46
7d_15C Seven days - 15 degrees Celsius 1619.65 800.35 2438.96
7d_30C Seven days - 30 degrees Celsius 892.23 471.28 1313.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.597973 no
3d_25C 7d_25C 0.763638 no
3d_25C 7d_15C 0.135802 no
3d_25C 7d_30C 0.561827 no
3d_25C 10d_25C 0.382446 no
5d_25C 7d_25C 0.871088 no
5d_25C 7d_15C 0.025128 yes
5d_25C 7d_30C 0.976742 no
5d_25C 10d_25C 0.801418 no
7d_25C 7d_15C 0.048261 yes
7d_25C 7d_30C 0.843591 no
7d_25C 10d_25C 0.647772 no
7d_15C 7d_30C 0.019353 yes
7d_15C 10d_25C 0.010411 yes
7d_30C 10d_25C 0.832271 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2908.t1
MGKEERNHINIVVIGHVDSGKSTTTGHMIYKCGGIDQRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITID
IALWKFQTAKYEVTVIDAPGHRDFIKNMITGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVKQLI
VALNKMDTCKWSEERYNEIVKETSNFIKKVGYNPKSVPFVPISGFNGDNMLEPSTNCPWYKGWEKETKAGKSTGK
TLIEAIDAIENPVRPSNKPLRLPLQDVYKISGIGTVPVGRVETGIITPGMIVTFAPANVTTEVKSVEMHHQQLKQ
GNPGDNVGFNVKNVSVKEVRRGNVASDSKNDPAAACDSFNAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELL
EKIDRRTGKATETSPKFIKSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKNAGGAGKV
TKAAAKAGKK*
Coding >Pro_DTO377G3_2|g2908.t1
ATGGGTAAGGAAGAGCGCAACCACATCAACATTGTCGTTATCGGCCACGTCGATTCCGGCAAGTCTACCACCACT
GGTCACATGATCTACAAGTGTGGTGGTATTGACCAGCGTACCATCGAGAAGTTCGAGAAGGAGGCTGCTGAGCTC
GGAAAGGGTTCCTTCAAGTACGCCTGGGTTCTTGACAAACTCAAGGCTGAGCGTGAGCGTGGTATCACCATCGAT
ATCGCTCTCTGGAAGTTCCAGACCGCCAAGTACGAGGTCACCGTCATCGATGCCCCCGGTCACCGTGATTTCATC
AAGAACATGATCACTGGTACCTCCCAGGCCGATTGCGCTATTCTCATCATCGCCTCCGGCACTGGTGAGTTCGAG
GCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTGCTCGCTTTCACCCTCGGTGTCAAGCAGCTCATC
GTTGCCCTCAACAAGATGGACACCTGCAAGTGGTCCGAGGAGCGTTACAACGAGATTGTCAAGGAGACCTCCAAC
TTCATCAAGAAGGTCGGCTACAACCCCAAGTCCGTTCCCTTCGTCCCCATCTCCGGCTTCAACGGCGACAACATG
CTCGAGCCCTCCACCAACTGCCCCTGGTACAAGGGTTGGGAGAAGGAGACCAAGGCTGGCAAGTCCACCGGAAAG
ACCCTCATCGAGGCCATCGATGCCATCGAGAACCCCGTCCGTCCCTCCAACAAGCCCCTCCGTCTTCCCCTCCAG
GATGTGTACAAGATCTCCGGTATTGGCACAGTTCCCGTCGGTCGTGTCGAGACTGGTATCATCACTCCCGGCATG
ATCGTCACCTTCGCCCCCGCCAACGTCACCACTGAAGTCAAGTCCGTTGAGATGCACCACCAGCAGCTCAAGCAG
GGTAACCCCGGTGACAACGTTGGTTTCAACGTCAAGAACGTCTCCGTCAAGGAGGTTCGCCGTGGTAACGTCGCT
TCCGACTCCAAGAACGACCCCGCTGCCGCCTGTGACTCCTTCAACGCTCAGGTCATTGTCCTGAACCACCCCGGT
CAGGTCGGCGCTGGATACGCCCCAGTCCTCGATTGCCACACTGCCCACATTGCTTGCAAGTTCGCTGAGCTCCTC
GAGAAGATCGATCGCCGTACCGGTAAGGCCACCGAGACCTCCCCCAAGTTCATCAAGTCCGGTGATGCCGCTATC
GTCAAGATGGTTCCCTCCAAGCCCATGTGTGTTGAGGCCTTCACCGACTACCCCCCTCTCGGTCGTTTCGCCGTC
CGTGACATGCGCCAGACCGTTGCCGTCGGTGTCATCAAGTCCGTCGAGAAGAACGCCGGTGGTGCTGGCAAGGTC
ACCAAGGCCGCTGCCAAGGCTGGCAAGAAATAA
Transcript >Pro_DTO377G3_2|g2908.t1
ATGGGTAAGGAAGAGCGCAACCACATCAACATTGTCGTTATCGGCCACGTCGATTCCGGCAAGTCTACCACCACT
GGTCACATGATCTACAAGTGTGGTGGTATTGACCAGCGTACCATCGAGAAGTTCGAGAAGGAGGCTGCTGAGCTC
GGAAAGGGTTCCTTCAAGTACGCCTGGGTTCTTGACAAACTCAAGGCTGAGCGTGAGCGTGGTATCACCATCGAT
ATCGCTCTCTGGAAGTTCCAGACCGCCAAGTACGAGGTCACCGTCATCGATGCCCCCGGTCACCGTGATTTCATC
AAGAACATGATCACTGGTACCTCCCAGGCCGATTGCGCTATTCTCATCATCGCCTCCGGCACTGGTGAGTTCGAG
GCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTGCTCGCTTTCACCCTCGGTGTCAAGCAGCTCATC
GTTGCCCTCAACAAGATGGACACCTGCAAGTGGTCCGAGGAGCGTTACAACGAGATTGTCAAGGAGACCTCCAAC
TTCATCAAGAAGGTCGGCTACAACCCCAAGTCCGTTCCCTTCGTCCCCATCTCCGGCTTCAACGGCGACAACATG
CTCGAGCCCTCCACCAACTGCCCCTGGTACAAGGGTTGGGAGAAGGAGACCAAGGCTGGCAAGTCCACCGGAAAG
ACCCTCATCGAGGCCATCGATGCCATCGAGAACCCCGTCCGTCCCTCCAACAAGCCCCTCCGTCTTCCCCTCCAG
GATGTGTACAAGATCTCCGGTATTGGCACAGTTCCCGTCGGTCGTGTCGAGACTGGTATCATCACTCCCGGCATG
ATCGTCACCTTCGCCCCCGCCAACGTCACCACTGAAGTCAAGTCCGTTGAGATGCACCACCAGCAGCTCAAGCAG
GGTAACCCCGGTGACAACGTTGGTTTCAACGTCAAGAACGTCTCCGTCAAGGAGGTTCGCCGTGGTAACGTCGCT
TCCGACTCCAAGAACGACCCCGCTGCCGCCTGTGACTCCTTCAACGCTCAGGTCATTGTCCTGAACCACCCCGGT
CAGGTCGGCGCTGGATACGCCCCAGTCCTCGATTGCCACACTGCCCACATTGCTTGCAAGTTCGCTGAGCTCCTC
GAGAAGATCGATCGCCGTACCGGTAAGGCCACCGAGACCTCCCCCAAGTTCATCAAGTCCGGTGATGCCGCTATC
GTCAAGATGGTTCCCTCCAAGCCCATGTGTGTTGAGGCCTTCACCGACTACCCCCCTCTCGGTCGTTTCGCCGTC
CGTGACATGCGCCAGACCGTTGCCGTCGGTGTCATCAAGTCCGTCGAGAAGAACGCCGGTGGTGCTGGCAAGGTC
ACCAAGGCCGCTGCCAAGGCTGGCAAGAAATAA
Gene >Pro_DTO377G3_2|g2908.t1
ATGGGGTATGTGACCATCACTCACTCGTTTCATTCTCATCAGAACAGACACTGACTCAGTCCCAACAGTAAGGAA
GAGCGCAACCACATCAACATTGTCGTTATCGGCCACGTCGATTCCGGCAAGTCTACCACCACTGGTCACATGATC
TACAAGTGTGGTGGTATTGACCAGCGTACCATCGAGAAGTTCGAGAAGGAGGCTGCTGAGCTCGGAAAGGGTTCC
TTCAAGTACGCCTGGGTTCTTGACAAACTCAAGGCTGAGCGTGAGCGTGGTATCACCATCGATATCGCTCTCTGG
AAGTTCCAGACCGCCAAGTACGAGGTCACCGTCATCGGTAAGAGACACTGTCCCATCCATTCAGTCAGTTGCACA
CATTCTAATACATTCTTACAGATGCCCCCGGTCACCGTGATTTCATCAAGAACATGATCACTGGTACCTCCCAGG
CCGATTGCGCTATTCTCATCATCGCCTCCGGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACCC
GTGAGCACGCTCTGCTCGCTTTCACCCTCGGTGTCAAGCAGCTCATCGTTGCCCTCAACAAGATGGACACCTGCA
AGTGGTCCGAGGAGCGTTACAACGAGATTGTCAAGGAGACCTCCAACTTCATCAAGAAGGTCGGCTACAACCCCA
AGTCCGTTCCCTTCGTCCCCATCTCCGGCTTCAACGGCGACAACATGCTCGAGCCCTCCACCAACTGCCCCTGGT
ACAAGGGTTGGGAGAAGGAGACCAAGGCTGGCAAGTCCACCGGAAAGACCCTCATCGAGGCCATCGATGCCATCG
AGAACCCCGTCCGTCCCTCCAACAAGCCCCTCCGTCTTCCCCTCCAGGATGTGTACAAGATCTCCGGTATTGGCA
CAGTTCCCGTCGGTCGTGTCGAGACTGGTATCATCACTCCCGGCATGATCGTCACCTTCGCCCCCGCCAACGTCA
CCACTGAAGTCAAGTCCGTTGAGATGCACCACCAGCAGCTCAAGCAGGGTAACCCCGGTGACAACGTTGGTTTCA
ACGTCAAGAACGTCTCCGTCAAGGAGGTTCGCCGTGGTAACGTCGCTTCCGACTCCAAGAACGACCCCGCTGCCG
CCTGTGACTCCTTCAACGCTCAGGTCATTGTCCTGAACCACCCCGGTCAGGTCGGCGCTGGATACGCCCCAGTCC
TCGATTGCCACACTGCCCACATTGCTTGCAAGTTCGCTGAGCTCCTCGAGAAGATCGATCGCCGTACCGGTAAGG
CCACCGAGACCTCCCCCAAGTTCATCAAGTCCGGTGATGCCGCTATCGTCAAGATGGTTCCCTCCAAGCCCATGT
GTGTTGAGGCCTTCACCGACTACCCCCCTCTCGGTCGTTTCGCCGTCCGTGACATGCGCCAGACCGTTGCCGTCG
GTGTCATCAAGTCCGTCGAGAAGAACGCCGGTGGTGCTGGCAAGGTCACCAAGGCCGCTGCCAAGGCTGGCAAGA
AATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail