Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2889.t1
Gene name
Locationscaffold_04:143250..144590
Strand+
Gene length (bp)1340
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01264 Chorismate_synt Chorismate synthase 2.7E-140 8 375

GO

GO Term Description Terminal node
GO:0004107 chorismate synthase activity Yes
GO:0009073 aromatic amino acid family biosynthetic process Yes
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0019752 carboxylic acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0016829 lyase activity No
GO:0043436 oxoacid metabolic process No
GO:0009072 aromatic amino acid family metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 44.40 25.32 63.47
5d_25C Five days - 25 degrees Celsius 35.10 19.08 51.12
7d_25C Seven days - 25 degrees Celsius 27.51 14.08 40.94
10d_25C Ten days - 25 degrees Celsius 16.57 7.19 25.95
7d_15C Seven days - 15 degrees Celsius 45.55 25.96 65.15
7d_30C Seven days - 30 degrees Celsius 26.20 13.26 39.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.388448 no
3d_25C 7d_25C 0.050710 no
3d_25C 7d_15C 0.944987 no
3d_25C 7d_30C 0.028871 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.402962 no
5d_25C 7d_15C 0.321481 no
5d_25C 7d_30C 0.293757 no
5d_25C 10d_25C 0.006742 yes
7d_25C 7d_15C 0.041414 yes
7d_25C 7d_30C 0.907413 no
7d_25C 10d_25C 0.075175 no
7d_15C 7d_30C 0.021163 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.113116 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2889.t1
MSTWGQYFRVTTYGESHCRSVGCIVDGCPPGLELTEADIQPQMTRRRPGQSALTTPRDEKDRVEIQSGTEFGITL
GTPIAMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKFLSLAHN
IEIVAFVSSVGNEHLFPPTPEHPSPSTNPEFLKLIETIDRKTVDTFSPIRCPETEAAARMTKVIEKFRDNHDSIG
GTVTCVIRNVPVGLGEPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVVNTSETGSPRLTTKT
NNSGGIQGGISNGASIYFRVAFKPAATIGQAQTTTSYSGEEGVLEAKGRHDPCVTPRAVPIVEAMSSLVIMDALM
AQYAREGAKNLLPQKAQTIRTSPTTAPNGAPSL*
Coding >Pro_DTO377G3_2|g2889.t1
ATGTCGACGTGGGGTCAATATTTCCGTGTCACCACTTATGGCGAGTCGCACTGTCGCTCTGTCGGCTGCATCGTC
GATGGATGTCCTCCGGGATTGGAACTCACCGAGGCCGACATTCAGCCCCAAATGACCCGGCGCCGTCCTGGCCAA
AGCGCTCTCACTACCCCGCGGGATGAGAAGGACCGAGTCGAGATCCAGTCAGGCACAGAGTTCGGTATCACTCTT
GGTACACCAATTGCCATGGTCGTCCGCAATGAGGACCAGCGCCCCAAGGACTACGGCGGCAGCACAATGGACCTG
TACCCTCGCCCTAGCCATGCCGACTTCACCTACCTTGAGAAGTACGGCGTCAAGGCCAGCAGCGGTGGTGGTCGC
AGCAGTGCCCGTGAGACCATTGGCCGTGTCGCTGCCGGCGCCATCGCCGAGAAATTCCTCAGCCTGGCCCATAAC
ATCGAGATCGTCGCCTTCGTATCCTCCGTCGGCAACGAGCACCTCTTCCCCCCAACCCCCGAGCACCCCTCCCCC
TCCACGAACCCAGAGTTCCTTAAGCTGATTGAGACGATTGACCGCAAAACCGTCGACACCTTCTCGCCCATCCGA
TGCCCGGAAACCGAGGCTGCTGCGCGCATGACCAAAGTCATCGAGAAGTTCCGCGACAACCACGACAGCATCGGT
GGAACCGTAACATGCGTGATCCGCAACGTGCCTGTGGGACTAGGTGAGCCCTGCTTCGATAAGCTTGAAGCCAAG
CTCGGCCACGCGATGCTCAGCATCCCCGCAACCAAGGGCTTCGAGATCGGCTCCGGCTTCGGTGGCTGCGAGGTC
CCCGGCTCAATCCACAACGACCCCTTCGTCGTCAACACGTCTGAAACCGGCAGCCCTCGCCTCACCACCAAGACT
AACAACTCTGGCGGTATCCAGGGTGGTATCTCCAACGGCGCGTCCATCTACTTCCGCGTCGCGTTCAAGCCCGCT
GCTACTATCGGCCAGGCGCAGACCACTACTTCTTACAGCGGTGAAGAGGGTGTCCTGGAGGCGAAGGGTCGTCAT
GATCCTTGTGTTACCCCCCGTGCTGTCCCTATTGTCGAGGCTATGTCGTCGCTGGTTATCATGGACGCACTCATG
GCTCAGTATGCCCGCGAGGGCGCCAAGAACTTGCTTCCCCAGAAGGCTCAGACTATTCGTACTAGTCCTACTACC
GCGCCCAATGGTGCTCCTTCGTTGTAG
Transcript >Pro_DTO377G3_2|g2889.t1
ATGTCGACGTGGGGTCAATATTTCCGTGTCACCACTTATGGCGAGTCGCACTGTCGCTCTGTCGGCTGCATCGTC
GATGGATGTCCTCCGGGATTGGAACTCACCGAGGCCGACATTCAGCCCCAAATGACCCGGCGCCGTCCTGGCCAA
AGCGCTCTCACTACCCCGCGGGATGAGAAGGACCGAGTCGAGATCCAGTCAGGCACAGAGTTCGGTATCACTCTT
GGTACACCAATTGCCATGGTCGTCCGCAATGAGGACCAGCGCCCCAAGGACTACGGCGGCAGCACAATGGACCTG
TACCCTCGCCCTAGCCATGCCGACTTCACCTACCTTGAGAAGTACGGCGTCAAGGCCAGCAGCGGTGGTGGTCGC
AGCAGTGCCCGTGAGACCATTGGCCGTGTCGCTGCCGGCGCCATCGCCGAGAAATTCCTCAGCCTGGCCCATAAC
ATCGAGATCGTCGCCTTCGTATCCTCCGTCGGCAACGAGCACCTCTTCCCCCCAACCCCCGAGCACCCCTCCCCC
TCCACGAACCCAGAGTTCCTTAAGCTGATTGAGACGATTGACCGCAAAACCGTCGACACCTTCTCGCCCATCCGA
TGCCCGGAAACCGAGGCTGCTGCGCGCATGACCAAAGTCATCGAGAAGTTCCGCGACAACCACGACAGCATCGGT
GGAACCGTAACATGCGTGATCCGCAACGTGCCTGTGGGACTAGGTGAGCCCTGCTTCGATAAGCTTGAAGCCAAG
CTCGGCCACGCGATGCTCAGCATCCCCGCAACCAAGGGCTTCGAGATCGGCTCCGGCTTCGGTGGCTGCGAGGTC
CCCGGCTCAATCCACAACGACCCCTTCGTCGTCAACACGTCTGAAACCGGCAGCCCTCGCCTCACCACCAAGACT
AACAACTCTGGCGGTATCCAGGGTGGTATCTCCAACGGCGCGTCCATCTACTTCCGCGTCGCGTTCAAGCCCGCT
GCTACTATCGGCCAGGCGCAGACCACTACTTCTTACAGCGGTGAAGAGGGTGTCCTGGAGGCGAAGGGTCGTCAT
GATCCTTGTGTTACCCCCCGTGCTGTCCCTATTGTCGAGGCTATGTCGTCGCTGGTTATCATGGACGCACTCATG
GCTCAGTATGCCCGCGAGGGCGCCAAGAACTTGCTTCCCCAGAAGGCTCAGACTATTCGTACTAGTCCTACTACC
GCGCCCAATGGTGCTCCTTCGTTGTAG
Gene >Pro_DTO377G3_2|g2889.t1
ATGTCGACGTGGGGTCAATATTTCCGTGTCACCACGTAGGTTACCCACCCCTCACAAAACACATTGTTACTGACA
CCCACAATTTAGTTATGGCGAGTCGCACTGTCGCTCTGTCGGCTGCATCGTCGATGGATGTCCTCCGGGATTGGA
ACTCACCGAGGCCGACATTCAGCCCCAAATGACCCGGCGCCGTCCTGGCCAAAGCGCTCTCACTACCCCGCGGGA
TGAGAAGGACCGAGTCGAGATCCAGTCAGGCACAGAGTTCGGTATCACTCTTGGTACACCAATTGCCATGGTCGT
CCGCAATGAGGACCAGCGCCCCAAGGACTACGGCGGCAGCACAATGGACCTGTACCCTCGCCCTAGCCATGCCGA
CTTCACCTACCTTGAGAAGTACGGCGTCAAGGCCAGCAGCGGTGGTGGTCGCAGCAGTGCCCGTGAGACCATTGG
TACGTCATGTGTAACTATCAACGCCAGAAGCGATTACTCTTGCTAATCCAATTCCCACAGGCCGTGTCGCTGCCG
GCGCCATCGCCGAGAAATTCCTCAGCCTGGCCCATAACATCGAGATCGTCGCCTTCGTATCCTCCGTCGGCAACG
AGCACCTCTTCCCCCCAACCCCCGAGCACCCCTCCCCCTCCACGAACCCAGAGTTCCTTAAGCTGATTGAGACGA
TTGACCGCAAAACCGTCGACACCTTCTCGCCCATCCGATGCCCGGAAACCGAGGCTGCTGCGCGCATGACCAAAG
TCATCGAGAAGTTCCGCGACAACCACGACAGCATCGGTGGAACCGTAACATGCGTGATCCGCAACGTGCCTGTGG
GACTAGGTGAGCCCTGCTTCGATAAGCTTGAAGCCAAGCTCGGCCACGCGATGCTCAGCATCCCCGCAACCAAGG
GCTTCGAGATCGGCTCCGGCTTCGGTGGCTGCGAGGTCCCCGGCTCAATCCACAACGACCCCTTCGTCGTCAACA
CGTCTGAAACCGGCAGCCCTCGCCTCACCACCAAGACTAACAACTCTGGCGGTATCCAGGGTGGTATCTCCAACG
GCGCGTCCATCTACTTCCGCGTCGCGTTCAAGCCCGCTGCTACTATCGGCCAGGCGCAGACCACTACTTCTTACA
GCGGTGAAGAGGGTGTCCTGGAGGCGAAGGGTCGTCATGATCCTTGTGTTACCCCCCGTGCTGTCCCTATTGTCG
AGGCTATGTCGTCGCTGGTTATCATGGACGCACTCATGGCTCAGTATGCCCGCGAGGGCGCCAAGAACTTGCTTC
CCCAGAAGGCTCAGACTATTCGTACTAGTCCTACTACCGCGCCCAATGGTGCTCCTTCGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail