Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2863.t1
Gene name
Locationscaffold_04:66342..69706
Strand-
Gene length (bp)3364
Transcript length (bp)3018
Coding sequence length (bp)3018
Protein length (aa) 1006

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 1.4E-50 121 325
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 4.3E-47 778 980
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.2E-20 343 709
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 9.0E-18 8 72
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.6E-16 413 521
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 1.8E-05 689 733

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 61 78 17
2 83 105 22
3 256 273 17
4 288 310 22
5 826 848 22
6 925 947 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2863.t1
MENAFLRTPAESLEHFKVSEQTGLSQSAVFHSRQQYGPNAIAEEPPTPMWELILEQFKDQLVLILLGSAAVSFVL
ALFEESDDWTAFVDPAVILTILILNAVVGVTQESSAEKAISALQEYSANEAKVIRDGMTRRVKAEDLVPGDVIQI
AVGDRVPADCRLLAIQSNSFRVDQAILTGESESVAKETRAIKDEQAVKQDQINMLFSGTTVVNGHATALVVLTGS
STAIGDIHESITSQISEPTPLKKKLNDFGDMLAKVITIICVLVWVINYENFNDPAFGGWTKGAIYYLKIAVSLGV
AAIPEGLAVVITTCLALGTRKMAQKNAVVRSLPSVETLGSCSVICSDKTGTLTTNQMSVEKIVYLTSSGTGFEEI
DVEGTTFTPEGKLTQNGNVVENLAVSSSTVAQLAEVAALCNGATLSHDAKSGVFSSIGEPTEGALRTLVEKIGST
DIALNQKLRRLPTSEKLHAASAHYESRLPLKATYEFSRDRKSMSVLVGEGEAQKLLVKGAPESILDRCSYVIQGA
NGSRVPVTQNHLKLLSEEVVEYGNRGLRVMAIASVDGVSGNPLLKNATTTEDYTKLEQNMTLIGLVGMLDPPRPE
VADSIKKCHAAGIRVIVITGDNRNTAESICRSIGVFGADEDLTGKSYTGREFDALSESEQVQAVQTASLFSRTEP
THKSRLVDLLQSLNHVVAMTGDGVNDAPALKKADIGVAMGTGTDVAKMASDMVLADDNFATITVAVEEGRSIYSN
TQQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALSFNPPDHDVMNRPPRRRDEPLVGG
WLLFRYMVVGIYVGAATVFGYVWWFVYNPDGPGISFWQLSHYHKCASQFPEIGCEMFSNDMGKSASTVSLSILVV
IEMLNAMNALSSSESLLTFFLGNNPMLIYAITLSMLLHFAILYIPFLQNLFSILPMDWNEWQAVLVISAPVILID
EVLKLAERRLYNTKAVNPVAQSGTVEIDFA*
Coding >Pro_DTO377G3_2|g2863.t1
ATGGAGAACGCCTTTCTCCGTACTCCAGCAGAGTCGCTGGAGCACTTCAAGGTGTCGGAGCAGACTGGTCTGTCG
CAGAGCGCGGTCTTCCATTCCAGACAACAGTATGGACCGAACGCTATTGCGGAAGAACCCCCGACTCCCATGTGG
GAACTGATTTTGGAACAATTTAAGGACCAATTGGTTCTTATCCTCCTTGGCTCGGCCGCCGTGTCTTTTGTGCTA
GCTCTCTTTGAAGAGAGCGACGATTGGACCGCATTTGTGGACCCCGCTGTTATCCTTACCATCCTCATCCTCAAT
GCTGTTGTCGGAGTGACCCAAGAAAGTAGCGCCGAAAAGGCAATTTCAGCTCTCCAGGAATATTCCGCCAACGAG
GCCAAGGTTATCCGCGATGGAATGACGCGAAGGGTCAAGGCCGAAGATCTGGTTCCCGGAGACGTGATTCAAATT
GCTGTCGGTGACCGTGTTCCTGCCGACTGCCGACTGCTCGCCATTCAGAGCAACAGCTTCCGTGTCGACCAGGCT
ATTCTGACTGGTGAGAGCGAAAGTGTTGCGAAGGAGACCCGGGCTATCAAGGATGAGCAGGCCGTCAAGCAGGAC
CAGATCAACATGCTTTTCTCTGGTACCACCGTTGTCAACGGCCACGCTACGGCTCTGGTCGTGTTGACCGGTAGC
TCGACTGCCATTGGAGATATCCACGAGAGCATCACTTCTCAGATCTCCGAGCCGACCCCCTTGAAAAAGAAGCTG
AACGACTTCGGTGACATGCTCGCCAAGGTTATTACCATCATCTGTGTCCTGGTTTGGGTTATCAACTATGAGAAC
TTCAATGACCCCGCGTTCGGTGGCTGGACTAAGGGAGCTATCTACTATCTGAAGATTGCTGTCTCTCTTGGTGTG
GCGGCTATCCCAGAGGGTCTGGCAGTGGTCATTACCACCTGTCTGGCTCTGGGTACCCGCAAGATGGCTCAAAAG
AACGCAGTCGTCCGGTCTCTTCCCTCTGTCGAGACCCTTGGCAGCTGCAGCGTAATTTGCTCTGACAAGACTGGA
ACCTTGACTACTAACCAGATGAGCGTCGAGAAGATTGTTTACCTGACCAGCTCTGGCACTGGATTCGAGGAGATT
GACGTCGAAGGCACTACTTTCACTCCCGAGGGCAAGCTCACCCAGAATGGCAATGTTGTCGAGAACCTGGCCGTT
TCTTCATCGACCGTGGCACAATTGGCCGAGGTTGCTGCCCTTTGCAACGGCGCTACTCTTTCCCACGATGCCAAG
AGCGGAGTCTTCTCCAGCATCGGTGAGCCCACTGAAGGCGCCCTGCGTACTCTGGTTGAGAAAATTGGATCCACC
GACATCGCCTTGAACCAAAAACTTCGTCGCCTCCCTACATCCGAAAAATTGCATGCCGCCAGCGCTCACTACGAG
TCCCGTCTTCCCCTCAAGGCCACCTATGAGTTCTCCCGTGACCGCAAGAGTATGTCTGTTCTCGTTGGCGAAGGC
GAGGCACAAAAGTTACTGGTCAAGGGTGCCCCTGAAAGCATCCTGGACCGTTGCTCGTACGTTATTCAAGGCGCC
AATGGATCTCGCGTTCCTGTGACTCAGAATCACTTGAAGCTTCTTTCCGAGGAAGTTGTTGAGTATGGTAACCGT
GGCCTTCGTGTCATGGCCATCGCAAGTGTTGACGGTGTCTCTGGAAACCCCCTCCTGAAGAACGCCACCACCACC
GAGGACTACACCAAGCTGGAACAGAACATGACTCTCATTGGTCTTGTCGGAATGTTGGATCCCCCTCGGCCTGAG
GTTGCCGATTCTATCAAGAAGTGCCACGCCGCCGGAATTCGTGTTATCGTCATCACCGGTGATAACCGCAATACC
GCCGAGTCTATCTGTCGCTCCATTGGTGTGTTCGGCGCCGACGAGGATCTCACGGGCAAGAGCTACACGGGCCGT
GAATTCGACGCTCTCAGTGAAAGTGAACAGGTGCAGGCCGTTCAGACCGCTTCCCTTTTCTCGCGCACTGAGCCT
ACCCACAAGTCTAGGCTTGTTGATCTCCTCCAGTCTTTGAACCACGTCGTCGCTATGACTGGTGACGGTGTCAAT
GACGCTCCCGCTCTCAAGAAGGCTGACATTGGCGTGGCCATGGGTACCGGAACCGATGTGGCCAAGATGGCCTCT
GACATGGTCTTGGCTGATGACAACTTCGCTACCATCACCGTCGCCGTCGAGGAAGGTCGTTCTATCTACAGCAAC
ACTCAACAGTTCATCCGTTACCTGATTTCTTCCAACATTGGAGAGGTCGTCTCTATCTTCCTGACTGCTGCCCTT
GGAATGCCCGAGGCTCTGATTCCCGTTCAACTGTTGTGGGTCAACCTTGTTACCGACGGTCTGCCTGCCACTGCT
CTGTCCTTCAACCCTCCGGACCACGATGTGATGAATCGCCCTCCCCGCCGTCGCGACGAGCCCCTTGTTGGCGGC
TGGTTGTTGTTCCGCTACATGGTTGTCGGCATCTACGTTGGTGCTGCCACCGTCTTTGGCTATGTCTGGTGGTTT
GTCTACAACCCCGATGGTCCTGGCATCTCTTTCTGGCAATTGTCCCACTACCACAAGTGTGCCTCTCAGTTCCCC
GAGATTGGCTGCGAAATGTTCAGCAACGATATGGGCAAATCTGCCTCCACCGTGTCTCTTTCCATCCTCGTGGTG
ATTGAGATGCTCAACGCCATGAACGCGCTGTCCTCGAGCGAGTCCCTCCTGACTTTCTTCTTGGGCAACAACCCC
ATGCTTATCTACGCTATCACTCTGTCCATGCTCCTTCACTTTGCCATCCTCTACATTCCCTTCCTCCAGAACCTG
TTCTCGATTCTGCCCATGGACTGGAATGAATGGCAGGCGGTGTTGGTGATCAGTGCACCTGTGATCTTGATTGAC
GAGGTCCTTAAGTTGGCCGAGCGTCGTCTTTACAACACGAAAGCCGTCAACCCGGTCGCCCAGAGCGGTACCGTC
GAGATAGATTTTGCCTGA
Transcript >Pro_DTO377G3_2|g2863.t1
ATGGAGAACGCCTTTCTCCGTACTCCAGCAGAGTCGCTGGAGCACTTCAAGGTGTCGGAGCAGACTGGTCTGTCG
CAGAGCGCGGTCTTCCATTCCAGACAACAGTATGGACCGAACGCTATTGCGGAAGAACCCCCGACTCCCATGTGG
GAACTGATTTTGGAACAATTTAAGGACCAATTGGTTCTTATCCTCCTTGGCTCGGCCGCCGTGTCTTTTGTGCTA
GCTCTCTTTGAAGAGAGCGACGATTGGACCGCATTTGTGGACCCCGCTGTTATCCTTACCATCCTCATCCTCAAT
GCTGTTGTCGGAGTGACCCAAGAAAGTAGCGCCGAAAAGGCAATTTCAGCTCTCCAGGAATATTCCGCCAACGAG
GCCAAGGTTATCCGCGATGGAATGACGCGAAGGGTCAAGGCCGAAGATCTGGTTCCCGGAGACGTGATTCAAATT
GCTGTCGGTGACCGTGTTCCTGCCGACTGCCGACTGCTCGCCATTCAGAGCAACAGCTTCCGTGTCGACCAGGCT
ATTCTGACTGGTGAGAGCGAAAGTGTTGCGAAGGAGACCCGGGCTATCAAGGATGAGCAGGCCGTCAAGCAGGAC
CAGATCAACATGCTTTTCTCTGGTACCACCGTTGTCAACGGCCACGCTACGGCTCTGGTCGTGTTGACCGGTAGC
TCGACTGCCATTGGAGATATCCACGAGAGCATCACTTCTCAGATCTCCGAGCCGACCCCCTTGAAAAAGAAGCTG
AACGACTTCGGTGACATGCTCGCCAAGGTTATTACCATCATCTGTGTCCTGGTTTGGGTTATCAACTATGAGAAC
TTCAATGACCCCGCGTTCGGTGGCTGGACTAAGGGAGCTATCTACTATCTGAAGATTGCTGTCTCTCTTGGTGTG
GCGGCTATCCCAGAGGGTCTGGCAGTGGTCATTACCACCTGTCTGGCTCTGGGTACCCGCAAGATGGCTCAAAAG
AACGCAGTCGTCCGGTCTCTTCCCTCTGTCGAGACCCTTGGCAGCTGCAGCGTAATTTGCTCTGACAAGACTGGA
ACCTTGACTACTAACCAGATGAGCGTCGAGAAGATTGTTTACCTGACCAGCTCTGGCACTGGATTCGAGGAGATT
GACGTCGAAGGCACTACTTTCACTCCCGAGGGCAAGCTCACCCAGAATGGCAATGTTGTCGAGAACCTGGCCGTT
TCTTCATCGACCGTGGCACAATTGGCCGAGGTTGCTGCCCTTTGCAACGGCGCTACTCTTTCCCACGATGCCAAG
AGCGGAGTCTTCTCCAGCATCGGTGAGCCCACTGAAGGCGCCCTGCGTACTCTGGTTGAGAAAATTGGATCCACC
GACATCGCCTTGAACCAAAAACTTCGTCGCCTCCCTACATCCGAAAAATTGCATGCCGCCAGCGCTCACTACGAG
TCCCGTCTTCCCCTCAAGGCCACCTATGAGTTCTCCCGTGACCGCAAGAGTATGTCTGTTCTCGTTGGCGAAGGC
GAGGCACAAAAGTTACTGGTCAAGGGTGCCCCTGAAAGCATCCTGGACCGTTGCTCGTACGTTATTCAAGGCGCC
AATGGATCTCGCGTTCCTGTGACTCAGAATCACTTGAAGCTTCTTTCCGAGGAAGTTGTTGAGTATGGTAACCGT
GGCCTTCGTGTCATGGCCATCGCAAGTGTTGACGGTGTCTCTGGAAACCCCCTCCTGAAGAACGCCACCACCACC
GAGGACTACACCAAGCTGGAACAGAACATGACTCTCATTGGTCTTGTCGGAATGTTGGATCCCCCTCGGCCTGAG
GTTGCCGATTCTATCAAGAAGTGCCACGCCGCCGGAATTCGTGTTATCGTCATCACCGGTGATAACCGCAATACC
GCCGAGTCTATCTGTCGCTCCATTGGTGTGTTCGGCGCCGACGAGGATCTCACGGGCAAGAGCTACACGGGCCGT
GAATTCGACGCTCTCAGTGAAAGTGAACAGGTGCAGGCCGTTCAGACCGCTTCCCTTTTCTCGCGCACTGAGCCT
ACCCACAAGTCTAGGCTTGTTGATCTCCTCCAGTCTTTGAACCACGTCGTCGCTATGACTGGTGACGGTGTCAAT
GACGCTCCCGCTCTCAAGAAGGCTGACATTGGCGTGGCCATGGGTACCGGAACCGATGTGGCCAAGATGGCCTCT
GACATGGTCTTGGCTGATGACAACTTCGCTACCATCACCGTCGCCGTCGAGGAAGGTCGTTCTATCTACAGCAAC
ACTCAACAGTTCATCCGTTACCTGATTTCTTCCAACATTGGAGAGGTCGTCTCTATCTTCCTGACTGCTGCCCTT
GGAATGCCCGAGGCTCTGATTCCCGTTCAACTGTTGTGGGTCAACCTTGTTACCGACGGTCTGCCTGCCACTGCT
CTGTCCTTCAACCCTCCGGACCACGATGTGATGAATCGCCCTCCCCGCCGTCGCGACGAGCCCCTTGTTGGCGGC
TGGTTGTTGTTCCGCTACATGGTTGTCGGCATCTACGTTGGTGCTGCCACCGTCTTTGGCTATGTCTGGTGGTTT
GTCTACAACCCCGATGGTCCTGGCATCTCTTTCTGGCAATTGTCCCACTACCACAAGTGTGCCTCTCAGTTCCCC
GAGATTGGCTGCGAAATGTTCAGCAACGATATGGGCAAATCTGCCTCCACCGTGTCTCTTTCCATCCTCGTGGTG
ATTGAGATGCTCAACGCCATGAACGCGCTGTCCTCGAGCGAGTCCCTCCTGACTTTCTTCTTGGGCAACAACCCC
ATGCTTATCTACGCTATCACTCTGTCCATGCTCCTTCACTTTGCCATCCTCTACATTCCCTTCCTCCAGAACCTG
TTCTCGATTCTGCCCATGGACTGGAATGAATGGCAGGCGGTGTTGGTGATCAGTGCACCTGTGATCTTGATTGAC
GAGGTCCTTAAGTTGGCCGAGCGTCGTCTTTACAACACGAAAGCCGTCAACCCGGTCGCCCAGAGCGGTACCGTC
GAGATAGATTTTGCCTGA
Gene >Pro_DTO377G3_2|g2863.t1
ATGGAGAACGCCTTTCTCCGTACTCCAGCAGAGTCGCTGGAGCACTTCAAGGTGTCGGAGCAGACTGGTCTGTCG
CAGAGCGCGGTCTTCCATTCCAGACAACAGTATGGACCGAACGGTTAGTACCCACCCCGCTGCAGAATGATGACA
TGGCTAAAACTGACATCTGCCGTTTATTTAGCTATTGCGGAAGAACCCCCGACTCCCATGTGGGAACTGATTTTG
GAACAATTTAAGGACCAATTGGTTCTTATCCTCCTTGGCTCGGCCGCCGTGTCTTTTGTGCTAGCTCTCTTTGAA
GAGAGCGACGATTGGACCGCATTTGTGGACCCCGCTGTTGTAAGTGCCTGGATATCCTGCGTTGCATCTGTATAC
CCATGTGTTCTATTATGCTGACCGAGGTTTGCTGTTGTTCACAGATCCTTACCATCCTCATCCTCAATGCTGTTG
TCGGAGTGACCCAAGAAAGTAGCGCCGAAAAGGCAATTTCAGCTCTCCAGGAATATTCCGCCAACGAGGCCAAGG
TTATCCGCGATGGAATGACGCGAAGGGTCAAGGCCGAAGATCTGGTTCCCGGAGACGTGATTCAAATTGCTGTCG
GTGACCGTGTTCCTGCCGACTGCCGACTGCTCGCCATTCAGAGCAACAGCTTCCGTGTCGACCAGGCTATTCTGA
CTGGTGAGAGCGAAAGTGTTGCGAAGGAGACCCGGGCTATCAAGGATGAGCAGGCCGTCAAGCAGGACCAGATCA
ACATGCTTTTCTCTGGTACCACCGTTGTCAACGGCCACGCTACGGCTCTGGTCGTGTTGACCGGTAGCTCGACTG
CCATTGGAGATATCCACGAGAGCATCACTTCTCAGATCTCCGAGCCGACCCCCTTGAAAAAGAAGCTGAACGACT
TCGGTGACATGCTCGCCAAGGTTATTACCATCATCTGTGTCCTGGTTTGGGTTATCAACTATGAGAACTTCAATG
ACCCCGCGTTCGGTGGCTGGACTAAGGGAGCTATCTACTATCTGAAGATTGCTGTCTCTCTTGGTGTGGCGGCTA
TCCCAGAGGGTCTGGCAGTGGTCATTACCACCTGTCTGGCTCTGGGTACCCGCAAGATGGCTCAAAAGAACGCAG
TCGTCCGGTCTCTTCCCTCTGTCGAGACCCTTGGCAGCTGCAGCGTAATTTGCTCTGACAAGACTGGAACCTTGA
CTACTAACCAGATGAGCGTCGAGAAGATTGTTTACCTGACCAGCTCTGGCACTGGATTCGAGGAGATTGACGTCG
AAGGCACTACTTTCACTCCCGAGGGCAAGCTCACCCAGAATGGCAATGTTGTCGAGAACCTGGCCGTTTCTTCAT
CGACCGTGGCACAATTGGCCGAGGTTGCTGCCCTTTGCAACGGCGCTACTCTTTCCCACGATGCCAAGAGCGGAG
TCTTCTCCAGCATCGGTGAGCCCACTGAAGGCGCCCTGCGTACTCTGGTTGAGAAAATTGGATCCACCGACATCG
CCTTGAACCAAAAACTTCGTCGCCTCCCTACATCCGAAAAATTGCATGCCGCCAGCGCTCACTACGAGTCCCGTC
TTCCCCTCAAGGCCACCTATGAGTTCTCCCGTGACCGCAAGAGTATGTCTGTTCTCGTTGGCGAAGGCGAGGCAC
AAAAGTTACTGGTCAAGGGTGCCCCTGAAAGCATCCTGGACCGTTGCTCGTACGTTATTCAAGGCGCCAATGGAT
CTCGCGTTCCTGTGACTCAGAATCACTTGAAGCTTCTTTCCGAGGAAGTTGTTGAGTATGGTAACCGTGGCCTTC
GTGTCATGGCCATCGCAAGTGTTGACGGTGTCTCTGGAAACCCCCTCCTGAAGAACGCCACCACCACCGAGGACT
ACACCAAGCTGGAACAGAACATGACTCTCATTGGTCTTGTCGGAATGTTGGATCCCCCTCGGCCTGAGGTTGCCG
ATTCTATCAAGAAGTGCCACGCCGCCGGAATTCGTGTTATCGTCATCACCGGTGATAACCGCAATACCGCCGAGT
CTATCTGTCGCTCCATTGGTGTGTTCGGCGCCGACGAGGATCTCACGGGCAAGAGCTACACGGGCCGTGAATTCG
ACGCTCTCAGTGAAAGTGAACAGGTGCAGGCCGTTCAGACCGCTTCCCTTTTCTCGCGCACTGAGCCTACCCACA
AGTCTAGGCTTGTTGATCTCCTCCAGTCTTTGAACCACGTCGTCGCTATGACTGGTGACGGTGTCAATGACGCTC
CCGCTCTCAAGAAGGCTGACATTGGCGTGGCCATGGGTACCGGAACCGATGTGGCCAAGATGGCCTCTGACATGG
TCTTGGCTGATGACAACTTCGCTACCATCACCGTCGCCGTCGAGGAAGGTCGTTCTATCTACAGCAACACTCAAC
AGTTCATCCGTTACCTGATTTCTTCCAACATTGGAGAGGTCGTCTCTATCTTCCTGACTGCTGCCCTTGGAATGC
CCGAGGCTCTGATTCCCGTTCAACTGTTGTGGGTCAACCTTGTTACCGACGGTCTGCCTGCCACTGCTCTGTCCT
TCAACCCTCCGGACCACGATGTGATGAATCGCCCTCCCCGCCGTCGCGACGAGCCCCTTGTTGGCGGCTGGTTGT
TGTTCCGCTACATGGTTGTCGGCATCTACGTTGGTGCTGCCACCGTCTTTGGCTATGTCTGGTGGTTTGTCTACA
ACCCCGATGGTCCTGGCATCTCTTTCTGGCAATTGGTAAGTCTCTAAAGTTTCCAGGTATTGATCGTGTTGCTAA
CCAGGTCAATTCAGTCCCACTACCACAAGTGTGCCTCTCAGTTCCCCGAGATTGGCTGCGAAATGTTCAGCAACG
ATATGGGCAAATCTGCCTCCACCGTGTCTCTTTCCATCCTCGTGGTGATTGAGATGCTCAACGCCATGAACGCGC
TGTCCTCGAGCGAGTCCCTCCTGACTTTCTTCTTGGGCAACAACCCCATGCTTATCTACGCTATCACTCTGTCCA
TGCTCCTTCACTTTGCCATCCTCTACATTCCCTTCCTCCAGAACCTGTTCTCGATTCTGCCCATGGACTGGAATG
AATGGCAGGCGGTGTTGGTGATCAGTGCACCTGTGATGTATGTGTCATTTCTCCTTAATCCTGAAAGAATATCTT
ACTAATCCACATTCCAGCTTGATTGACGAGGTCCTTAAGTTGGCCGAGCGTCGTCTTTACAACACGAAAGCCGTC
AACCCGGTCGCCCAGAGCGGTACCGTCGGTAAGCCCAAGCGGGCATAAAGGATGGGTCTAAATTGGACCCTACCC
TCCTAGATATCTGCTCGCGCAGGAGCTAACTAACCGGTGTGTAATAGAGATAGATTTTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail