Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2862.t1
Gene name
Locationscaffold_04:63842..65599
Strand-
Gene length (bp)1757
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.6E-15 41 388
PF00083 Sugar_tr Sugar (and other) transporter 7.9E-06 88 224

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 32 51 19
2 71 93 22
3 100 122 22
4 165 187 22
5 200 222 22
6 255 277 22
7 314 336 22
8 346 368 22
9 375 397 22
10 407 429 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.09 0.38 3.79
5d_25C Five days - 25 degrees Celsius 1.12 0.08 2.15
7d_25C Seven days - 25 degrees Celsius 1.20 0.01 2.40
10d_25C Ten days - 25 degrees Celsius 0.67 0.00 1.44
7d_15C Seven days - 15 degrees Celsius 1.41 0.04 2.77
7d_30C Seven days - 30 degrees Celsius 2.37 0.47 4.26

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.217002 no
3d_25C 7d_25C 0.329624 no
3d_25C 7d_15C 0.508024 no
3d_25C 7d_30C 0.845505 no
3d_25C 10d_25C 0.043201 yes
5d_25C 7d_25C 0.929196 no
5d_25C 7d_15C 0.745851 no
5d_25C 7d_30C 0.120895 no
5d_25C 10d_25C 0.429485 no
7d_25C 7d_15C 0.847642 no
7d_25C 7d_30C 0.212879 no
7d_25C 10d_25C 0.393825 no
7d_15C 7d_30C 0.351332 no
7d_15C 10d_25C 0.246768 no
7d_30C 10d_25C 0.023923 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2862.t1
MGVKEFLKSRSGLRVDNRATTSAATLTLRQSLWPLTLVTTLFFLWGFAYGLLDTLNSHFQKTLHIDRGRSAGLQA
AYFGAYPLASLGYANWILRNYGYKTVFIFGLCLYGIGALCMWPAGLNQSFGGFCGATLVIGSGLGSLETAANPYL
TVCGPPRYSEIRINFAQAFNAIGTVVGPVLGSYVFFTETEDDVAALQRVQWVYLAIGVFVFLLAGVFFLSNIPEV
TDEDMAFQVTQTHVDEQDKPFWKQYKLFHATLAQFTYTGAQVAIAGYFINYVKDTWTGTSSATAAKYLAGAQGAF
AVGRFFGSGIMKFVRARWVFLLYLTCTVAFLAASVTQTKQVGLAMLFMTLFFESVCFPTIMALGIRGLGRHYKRG
SGFIVAGVSGGAVVPPILGHVADMHDNTGFAFIVPTMFMVVAWTYAIAVNFVPSYTDTVDRIGGSDVGLESQNIK
DEEAVMDSHDIDDEKHQAVHLER*
Coding >Pro_DTO377G3_2|g2862.t1
ATGGGCGTCAAGGAATTCCTCAAAAGCCGTTCGGGCTTGCGTGTTGATAATCGTGCGACTACTTCTGCTGCTACT
CTGACTCTACGACAGAGTCTGTGGCCCTTGACCCTAGTCACGACCTTATTCTTCTTATGGGGCTTTGCGTATGGT
TTGCTGGACACCCTCAACTCACATTTCCAGAAAACCCTACATATCGACCGTGGCCGCTCAGCTGGTCTTCAAGCA
GCCTACTTTGGCGCATACCCCTTAGCCTCCCTCGGCTACGCAAACTGGATCCTCCGCAACTACGGCTACAAGACC
GTCTTCATCTTCGGTCTGTGCCTATACGGTATTGGAGCCCTGTGCATGTGGCCCGCAGGTTTAAACCAATCCTTC
GGCGGCTTCTGTGGTGCCACATTAGTCATTGGCTCGGGACTGGGGTCTCTTGAGACAGCGGCTAATCCCTACCTA
ACCGTCTGCGGTCCGCCCCGCTATTCTGAGATCAGAATCAACTTTGCCCAGGCCTTCAATGCAATCGGCACAGTC
GTCGGCCCCGTTCTGGGCTCTTATGTCTTCTTCACCGAGACAGAGGACGATGTAGCAGCCCTGCAGCGCGTGCAG
TGGGTCTACCTCGCCATCGGGGTCTTCGTTTTCTTGCTCGCCGGCGTATTCTTCCTCTCCAATATTCCCGAAGTC
ACAGACGAGGACATGGCCTTCCAGGTGACGCAGACGCATGTGGACGAGCAGGATAAGCCTTTCTGGAAACAGTAC
AAGCTTTTCCATGCGACACTGGCGCAATTCACGTATACAGGCGCGCAGGTCGCTATCGCAGGCTATTTCATCAAC
TACGTCAAAGATACCTGGACGGGTACATCTAGCGCCACAGCAGCGAAGTACCTCGCTGGGGCACAGGGCGCATTC
GCAGTCGGCAGATTTTTCGGCTCGGGCATTATGAAATTCGTGCGGGCGCGCTGGGTCTTCCTGCTGTATTTAACG
TGCACGGTAGCGTTCCTCGCTGCGTCGGTCACGCAGACCAAGCAGGTTGGTCTCGCTATGCTGTTCATGACGCTC
TTCTTTGAGTCTGTTTGCTTCCCGACGATCATGGCGCTGGGAATCCGTGGCCTCGGACGCCATTACAAGCGCGGC
TCTGGGTTTATTGTTGCTGGTGTTTCTGGAGGTGCTGTGGTGCCGCCTATTCTGGGTCATGTTGCTGATATGCAT
GATAATACGGGATTCGCGTTTATTGTTCCGACTATGTTTATGGTCGTCGCTTGGACTTACGCTATTGCTGTGAAC
TTTGTTCCGTCGTATACTGATACCGTGGATAGGATTGGCGGGAGTGACGTTGGTCTTGAGAGTCAGAATATCAAA
GACGAGGAGGCTGTTATGGACTCTCATGATATCGATGACGAGAAGCACCAAGCCGTTCATTTAGAGCGGTGA
Transcript >Pro_DTO377G3_2|g2862.t1
ATGGGCGTCAAGGAATTCCTCAAAAGCCGTTCGGGCTTGCGTGTTGATAATCGTGCGACTACTTCTGCTGCTACT
CTGACTCTACGACAGAGTCTGTGGCCCTTGACCCTAGTCACGACCTTATTCTTCTTATGGGGCTTTGCGTATGGT
TTGCTGGACACCCTCAACTCACATTTCCAGAAAACCCTACATATCGACCGTGGCCGCTCAGCTGGTCTTCAAGCA
GCCTACTTTGGCGCATACCCCTTAGCCTCCCTCGGCTACGCAAACTGGATCCTCCGCAACTACGGCTACAAGACC
GTCTTCATCTTCGGTCTGTGCCTATACGGTATTGGAGCCCTGTGCATGTGGCCCGCAGGTTTAAACCAATCCTTC
GGCGGCTTCTGTGGTGCCACATTAGTCATTGGCTCGGGACTGGGGTCTCTTGAGACAGCGGCTAATCCCTACCTA
ACCGTCTGCGGTCCGCCCCGCTATTCTGAGATCAGAATCAACTTTGCCCAGGCCTTCAATGCAATCGGCACAGTC
GTCGGCCCCGTTCTGGGCTCTTATGTCTTCTTCACCGAGACAGAGGACGATGTAGCAGCCCTGCAGCGCGTGCAG
TGGGTCTACCTCGCCATCGGGGTCTTCGTTTTCTTGCTCGCCGGCGTATTCTTCCTCTCCAATATTCCCGAAGTC
ACAGACGAGGACATGGCCTTCCAGGTGACGCAGACGCATGTGGACGAGCAGGATAAGCCTTTCTGGAAACAGTAC
AAGCTTTTCCATGCGACACTGGCGCAATTCACGTATACAGGCGCGCAGGTCGCTATCGCAGGCTATTTCATCAAC
TACGTCAAAGATACCTGGACGGGTACATCTAGCGCCACAGCAGCGAAGTACCTCGCTGGGGCACAGGGCGCATTC
GCAGTCGGCAGATTTTTCGGCTCGGGCATTATGAAATTCGTGCGGGCGCGCTGGGTCTTCCTGCTGTATTTAACG
TGCACGGTAGCGTTCCTCGCTGCGTCGGTCACGCAGACCAAGCAGGTTGGTCTCGCTATGCTGTTCATGACGCTC
TTCTTTGAGTCTGTTTGCTTCCCGACGATCATGGCGCTGGGAATCCGTGGCCTCGGACGCCATTACAAGCGCGGC
TCTGGGTTTATTGTTGCTGGTGTTTCTGGAGGTGCTGTGGTGCCGCCTATTCTGGGTCATGTTGCTGATATGCAT
GATAATACGGGATTCGCGTTTATTGTTCCGACTATGTTTATGGTCGTCGCTTGGACTTACGCTATTGCTGTGAAC
TTTGTTCCGTCGTATACTGATACCGTGGATAGGATTGGCGGGAGTGACGTTGGTCTTGAGAGTCAGAATATCAAA
GACGAGGAGGCTGTTATGGACTCTCATGATATCGATGACGAGAAGCACCAAGCCGTTCATTTAGAGCGGTGA
Gene >Pro_DTO377G3_2|g2862.t1
ATGGGCGTCAAGGAATTCCTCAAAAGCCGTTCGGGCTTGCGTGTTGATAATCGTGCGACTACTTCTGCTGCTACT
CTGACTCTACGACAGAGTCTGTGGCCCTTGACCCTAGTCACGACCTTATTCTTCTTATGGGTATGCTACGGTATC
TCGTTTATAGCCAGTCCTCCCACTAAGACTTCAATTAGGGCTTTGCGTATGGTTTGCTGGACACCCTCAACTCAC
ATTTCCAGAAAACCCTACATATCGACCGTGGCCGCTCAGCTGGTCTTCAAGCAGCCTACTTTGGGTATGGAATCT
CTCGATAACATATGTATTATAAAAAAAGATACCACTCTAACAAAACCCAGCGCATACCCCTTAGCCTCCCTCGGC
TACGCAAACTGGATCCTCCGCAACTACGGCTACAAGACCGTCTTCATCTTCGGTCTGTGCCTATACGGTATTGGA
GCCCTGTGCATGTGGCCCGCAGGTTTAAACCAATCCTTCGGCGGCTTCTGTGGTGCCACATTAGTCATTGGCTCG
GGACTGGGGTCTCTTGAGACAGCGGCTAATCCCTACCTAACCGGTAAGACATTCATATGCTCCACAGATAATTAA
GCATAGACATTAATAGCTGCCCATTTGAATCTGCCTAGTCTGCGGTCCGCCCCGCTATTCTGAGATCAGAATCAA
CTTTGCCCAGGCCTTCAATGCAATCGGCACAGTCGTCGGCCCCGTTCTGGGCTCTTATGTCTTCTTCACCGAGAC
AGAGGACGATGTAGCAGCCCTGCAGCGCGTGCAGTGGGTCTACCTCGCCATCGGGGTCTTCGTTTTCTTGCTCGC
CGGCGTATTCTTCCTCTCCAATATTCCCGAAGTCACAGACGAGGACATGGCCTTCCAGGTGACGCAGACGCATGT
GGACGAGCAGGATAAGCCTTTCTGGAAACAGTACAAGCTTTTCCATGCGACACTGGCGCAATTCACGTATACAGG
CGCGCAGGGTGCGTTTCCTACCACCCTTTATCTTATACTTCTCTCTTAATATTCCATCAAGCTAACTCTTTCCTC
AGTCGCTATCGCAGGCTATTTCATCAACTACGTCAAAGATACCTGGACGGGTACATCTAGCGCCACAGCAGCGAA
GTACCTCGCTGGGGCACAGGGCGCATTCGCAGTCGGCAGATTTTTCGGCTCGGGCATTATGAAATTCGTGCGGGC
GCGCTGGGTCTTCCTGCTGTATTTAACGTGCACGGTAGCGTTCCTCGCTGCGTCGGTCACGCAGACCAAGCAGGT
TGGTCTCGCTATGCTGTTCATGACGCTCTTCTTTGAGTCTGTTTGCTTCCCGACGATCATGGCGCTGGGAATCCG
TGGCCTCGGACGCCATTACAAGCGCGGCTCTGGGTTTATTGTTGCTGGTGTTTCTGGAGGTGCTGTGGTGCCGCC
TATTCTGGGTCATGTTGCTGATATGCATGATAATACGGGATTCGCGTTTATTGTTCCGACTATGGTATGTTCTGC
TCTTAGATGGGGGTTTCTTGTTTTCGTTTCCGTATCTACCCTGTTAGATCGGTGGCTAATGCTGGTTGCAGTTTA
TGGTCGTCGCTTGGACTTACGCTATTGCTGTGAACTTTGTTCCGTCGTATACTGATACCGTGGATAGGATTGGCG
GGAGTGACGTTGGTCTTGAGAGTCAGAATATCAAAGACGAGGAGGCTGTTATGGACTCTCATGATATCGATGACG
AGAAGCACCAAGCCGTTCATTTAGAGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail