Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2861.t1
Gene name
Locationscaffold_04:58819..61711
Strand+
Gene length (bp)2892
Transcript length (bp)2616
Coding sequence length (bp)2616
Protein length (aa) 872

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.1E-66 40 287
PF07714 Pkinase_Tyr Protein tyrosine kinase 4.9E-41 42 282
PF14531 Kinase-like Kinase-like 1.5E-07 136 242
PF12330 Haspin_kinase Haspin like kinase domain 2.4E-06 131 188

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0036211 protein modification process No
GO:0044260 cellular macromolecule metabolic process No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0140096 catalytic activity, acting on a protein No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0006464 cellular protein modification process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:1901564 organonitrogen compound metabolic process No
GO:0016301 kinase activity No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0044237 cellular metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0019538 protein metabolic process No
GO:0005488 binding No
GO:0016310 phosphorylation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043412 macromolecule modification No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044267 cellular protein metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2861.t1
MPPRTRAGVQSQKQKEKLANSYNELLEEFSSKDLRTVGNYTLGRLIGKGSFGKVYLASHKLTNGSKVVLKSSSKE
DTNLVREIHHHRQFLHPHIARLYEVVVTESLVWLVLEYCPGDELYNYLLRHGPLPVEKVKRIFTQLVGAVAYVHS
KSCVHRDLKLENILLDKQENVKLCDFGFTREYEGKASYLQTFCGTICYSAPEMLKGEKYAGEKVDVWSLGIILYA
LLAGELPFDDDDDQITKKRILSDEPTFNGKFTDDAKALVSLLLSKRPLIRPSLDEILAHPFLAEHAPQQLAILKI
PRPSPFTTPLEKTTLQRMKSAGVNIDEVIENVLAQRCDPLAGWWALLIEKEQRKERKRERKRRERDAEAKNIRRL
SATSSRLEKRSSALMEVEEEGMGLRDRGRRDRRSLPSQLAVPDLPALPEPLPVFPIEVTTPPLPLDKDSIRSHNS
TRRRPVPPPKDRRRSRPSILHVSASQPELTQHHGIFRRRTSRRHQYPILSQLASLKHWFVESAKRARSPHAKSTS
SRKFLSEKLSPAKSQDTGKTPAPLASPASEVAGEDVVTPTQAKRASNASSLAPSSASYRQNRHSYPHQPRPLNTS
HNSHRNSLSPSPITPRGSYRRSSAGLRGRKSTSSSVSSIRSIHHARAHSKASSISSNSVDTISTPTARASRSPHS
SIKVLPTTPGASSRFPSNIRLVRGPGGAPREFGDHLGQMPSSFNEAVPGPLLYSPSSSLVFARRKRSLFKGPMIH
TTNLMVSGGIANSSMPGQPMDTSGPDLAPGRPAARKSQIIEEEEDVEGIEEEIEEVDEFEEPTTPGGFFTPDEQP
AETESPSSGRTPFDPILNLDTSPLRPPRSSSLRSPSDTPDKIGIAE*
Coding >Pro_DTO377G3_2|g2861.t1
ATGCCGCCCCGAACAAGAGCGGGGGTTCAAAGCCAGAAACAAAAGGAGAAGCTTGCCAACTCCTACAATGAGCTC
CTTGAGGAGTTCTCCTCCAAGGATCTTCGGACTGTAGGAAATTATACATTGGGGCGGCTAATTGGGAAAGGTTCC
TTCGGCAAGGTTTATCTCGCCTCGCATAAGCTCACCAATGGCTCCAAGGTGGTACTCAAATCGTCCAGCAAGGAG
GACACCAATCTCGTGCGCGAGATCCATCACCATCGCCAATTCCTCCACCCTCATATCGCGCGCCTATACGAAGTG
GTGGTAACTGAGAGCCTCGTTTGGCTTGTGCTAGAGTATTGTCCTGGCGACGAACTTTACAACTACCTCCTTCGA
CACGGCCCCCTACCGGTAGAGAAGGTGAAGCGCATATTTACACAGTTGGTTGGAGCGGTCGCCTACGTCCACAGT
AAATCCTGTGTGCATCGCGACTTGAAACTGGAAAACATATTACTGGATAAACAAGAAAACGTCAAGCTTTGCGAT
TTTGGGTTCACGCGTGAATATGAAGGCAAGGCTAGCTATCTTCAGACATTCTGCGGGACGATATGCTATAGCGCG
CCCGAGATGCTCAAGGGGGAGAAATACGCGGGCGAAAAAGTGGATGTATGGAGCTTGGGGATCATTCTATATGCG
CTTTTGGCAGGCGAGCTGCCGTTTGACGACGATGACGACCAAATCACCAAAAAGCGGATTCTGTCGGACGAGCCG
ACCTTCAACGGAAAGTTCACGGACGATGCTAAGGCTCTGGTCAGTCTCCTATTGTCCAAACGGCCTTTGATTCGA
CCCAGTCTGGATGAGATCCTGGCACATCCTTTCCTTGCGGAACATGCTCCTCAACAACTTGCAATCCTGAAAATC
CCAAGACCATCGCCATTTACTACGCCACTGGAGAAGACTACCTTGCAGCGGATGAAAAGCGCTGGGGTCAATATT
GACGAGGTTATTGAAAATGTCTTGGCTCAGCGGTGCGACCCACTGGCTGGCTGGTGGGCCCTACTGATTGAAAAG
GAACAAAGGAAGGAAAGAAAGAGAGAGCGCAAGCGTCGGGAGCGGGATGCTGAAGCAAAAAACATTCGTCGTCTG
AGCGCTACCAGCAGTCGCCTAGAAAAGCGATCATCGGCTTTAATGGAGGTGGAGGAAGAAGGCATGGGGTTGCGC
GATCGTGGGAGACGGGATAGAAGAAGCTTACCATCCCAGTTGGCAGTGCCAGATCTTCCTGCGCTTCCAGAACCG
CTCCCTGTATTCCCAATTGAGGTGACCACGCCACCATTGCCGCTCGACAAAGATTCTATACGATCCCACAACTCG
ACGCGACGGCGCCCAGTGCCTCCGCCAAAAGACAGGCGGCGATCACGGCCCAGCATACTGCATGTTAGCGCATCA
CAGCCGGAGTTGACACAGCATCACGGCATCTTCCGGCGTCGCACTAGTCGTCGTCACCAGTATCCGATACTCAGC
CAACTAGCGTCTCTCAAACATTGGTTTGTAGAGTCGGCGAAAAGAGCGCGGTCTCCCCATGCCAAATCGACGAGC
TCGCGGAAGTTTCTTTCTGAAAAGTTGAGCCCGGCTAAGAGTCAAGATACTGGGAAAACCCCTGCACCTTTAGCG
TCCCCAGCAAGCGAGGTCGCAGGGGAGGATGTTGTTACACCCACCCAGGCAAAACGAGCCTCCAATGCCAGCAGC
CTCGCTCCTAGCAGTGCCTCATACCGCCAAAACCGCCACTCTTACCCTCACCAGCCGCGCCCATTGAACACCAGT
CATAATAGTCATCGAAACTCTCTCTCGCCCTCACCTATCACCCCACGCGGGTCCTATCGGCGTTCATCGGCCGGG
CTCCGAGGTCGCAAATCCACATCCTCCTCGGTATCATCGATCCGCAGCATTCACCACGCTCGTGCTCACTCCAAG
GCCTCTTCGATTTCCTCCAACAGTGTGGATACTATCTCGACACCCACTGCCAGAGCCTCCAGGTCGCCTCACTCA
TCTATCAAAGTGCTGCCCACCACTCCAGGCGCCTCATCCCGCTTTCCGAGCAATATTCGGTTGGTAAGAGGGCCA
GGCGGAGCACCTCGAGAGTTCGGTGACCACTTAGGTCAGATGCCGTCGTCGTTCAACGAAGCGGTACCAGGGCCA
CTGCTCTACTCACCCTCTTCAAGTCTGGTGTTTGCAAGGCGAAAGAGATCTCTTTTCAAGGGTCCTATGATCCAT
ACCACCAACTTGATGGTGTCTGGTGGGATAGCCAACTCCTCTATGCCGGGTCAGCCAATGGATACCAGCGGGCCT
GACCTCGCACCAGGGCGGCCTGCTGCACGCAAGAGCCAAATCATCGAGGAAGAGGAAGATGTCGAAGGAATTGAG
GAAGAAATTGAAGAAGTCGATGAGTTCGAAGAACCTACTACACCAGGAGGTTTCTTTACCCCTGATGAGCAGCCA
GCCGAGACCGAATCTCCCTCAAGCGGCAGAACACCATTTGATCCTATTCTAAACCTTGATACCAGTCCCCTTCGG
CCTCCTCGCTCCTCCTCTTTGCGCTCGCCGTCCGATACCCCAGACAAGATCGGCATCGCCGAATAA
Transcript >Pro_DTO377G3_2|g2861.t1
ATGCCGCCCCGAACAAGAGCGGGGGTTCAAAGCCAGAAACAAAAGGAGAAGCTTGCCAACTCCTACAATGAGCTC
CTTGAGGAGTTCTCCTCCAAGGATCTTCGGACTGTAGGAAATTATACATTGGGGCGGCTAATTGGGAAAGGTTCC
TTCGGCAAGGTTTATCTCGCCTCGCATAAGCTCACCAATGGCTCCAAGGTGGTACTCAAATCGTCCAGCAAGGAG
GACACCAATCTCGTGCGCGAGATCCATCACCATCGCCAATTCCTCCACCCTCATATCGCGCGCCTATACGAAGTG
GTGGTAACTGAGAGCCTCGTTTGGCTTGTGCTAGAGTATTGTCCTGGCGACGAACTTTACAACTACCTCCTTCGA
CACGGCCCCCTACCGGTAGAGAAGGTGAAGCGCATATTTACACAGTTGGTTGGAGCGGTCGCCTACGTCCACAGT
AAATCCTGTGTGCATCGCGACTTGAAACTGGAAAACATATTACTGGATAAACAAGAAAACGTCAAGCTTTGCGAT
TTTGGGTTCACGCGTGAATATGAAGGCAAGGCTAGCTATCTTCAGACATTCTGCGGGACGATATGCTATAGCGCG
CCCGAGATGCTCAAGGGGGAGAAATACGCGGGCGAAAAAGTGGATGTATGGAGCTTGGGGATCATTCTATATGCG
CTTTTGGCAGGCGAGCTGCCGTTTGACGACGATGACGACCAAATCACCAAAAAGCGGATTCTGTCGGACGAGCCG
ACCTTCAACGGAAAGTTCACGGACGATGCTAAGGCTCTGGTCAGTCTCCTATTGTCCAAACGGCCTTTGATTCGA
CCCAGTCTGGATGAGATCCTGGCACATCCTTTCCTTGCGGAACATGCTCCTCAACAACTTGCAATCCTGAAAATC
CCAAGACCATCGCCATTTACTACGCCACTGGAGAAGACTACCTTGCAGCGGATGAAAAGCGCTGGGGTCAATATT
GACGAGGTTATTGAAAATGTCTTGGCTCAGCGGTGCGACCCACTGGCTGGCTGGTGGGCCCTACTGATTGAAAAG
GAACAAAGGAAGGAAAGAAAGAGAGAGCGCAAGCGTCGGGAGCGGGATGCTGAAGCAAAAAACATTCGTCGTCTG
AGCGCTACCAGCAGTCGCCTAGAAAAGCGATCATCGGCTTTAATGGAGGTGGAGGAAGAAGGCATGGGGTTGCGC
GATCGTGGGAGACGGGATAGAAGAAGCTTACCATCCCAGTTGGCAGTGCCAGATCTTCCTGCGCTTCCAGAACCG
CTCCCTGTATTCCCAATTGAGGTGACCACGCCACCATTGCCGCTCGACAAAGATTCTATACGATCCCACAACTCG
ACGCGACGGCGCCCAGTGCCTCCGCCAAAAGACAGGCGGCGATCACGGCCCAGCATACTGCATGTTAGCGCATCA
CAGCCGGAGTTGACACAGCATCACGGCATCTTCCGGCGTCGCACTAGTCGTCGTCACCAGTATCCGATACTCAGC
CAACTAGCGTCTCTCAAACATTGGTTTGTAGAGTCGGCGAAAAGAGCGCGGTCTCCCCATGCCAAATCGACGAGC
TCGCGGAAGTTTCTTTCTGAAAAGTTGAGCCCGGCTAAGAGTCAAGATACTGGGAAAACCCCTGCACCTTTAGCG
TCCCCAGCAAGCGAGGTCGCAGGGGAGGATGTTGTTACACCCACCCAGGCAAAACGAGCCTCCAATGCCAGCAGC
CTCGCTCCTAGCAGTGCCTCATACCGCCAAAACCGCCACTCTTACCCTCACCAGCCGCGCCCATTGAACACCAGT
CATAATAGTCATCGAAACTCTCTCTCGCCCTCACCTATCACCCCACGCGGGTCCTATCGGCGTTCATCGGCCGGG
CTCCGAGGTCGCAAATCCACATCCTCCTCGGTATCATCGATCCGCAGCATTCACCACGCTCGTGCTCACTCCAAG
GCCTCTTCGATTTCCTCCAACAGTGTGGATACTATCTCGACACCCACTGCCAGAGCCTCCAGGTCGCCTCACTCA
TCTATCAAAGTGCTGCCCACCACTCCAGGCGCCTCATCCCGCTTTCCGAGCAATATTCGGTTGGTAAGAGGGCCA
GGCGGAGCACCTCGAGAGTTCGGTGACCACTTAGGTCAGATGCCGTCGTCGTTCAACGAAGCGGTACCAGGGCCA
CTGCTCTACTCACCCTCTTCAAGTCTGGTGTTTGCAAGGCGAAAGAGATCTCTTTTCAAGGGTCCTATGATCCAT
ACCACCAACTTGATGGTGTCTGGTGGGATAGCCAACTCCTCTATGCCGGGTCAGCCAATGGATACCAGCGGGCCT
GACCTCGCACCAGGGCGGCCTGCTGCACGCAAGAGCCAAATCATCGAGGAAGAGGAAGATGTCGAAGGAATTGAG
GAAGAAATTGAAGAAGTCGATGAGTTCGAAGAACCTACTACACCAGGAGGTTTCTTTACCCCTGATGAGCAGCCA
GCCGAGACCGAATCTCCCTCAAGCGGCAGAACACCATTTGATCCTATTCTAAACCTTGATACCAGTCCCCTTCGG
CCTCCTCGCTCCTCCTCTTTGCGCTCGCCGTCCGATACCCCAGACAAGATCGGCATCGCCGAATAA
Gene >Pro_DTO377G3_2|g2861.t1
ATGCCGCCCCGAACAAGAGCGGGGGTTCAAAGCCAGAAACAAAAGGAGAAGGTGCGTCATCAGGGATGCGACATA
GGGAGCTCCACCGGGTTTCCTTTGTTCGAGCCTTGCGCAGAGTCCGTGGAAATATGGCTAACTCGGAATTCTCGA
CAGCTTGCCAACTCCTACAATGAGCTCCTTGAGTAAGCGATCTTGCTTCCGGTCTGGATGGTCAGTTGCGCTAAC
GTGGTGCTTCTCTACAGGGAGTTCTCCTCCAAGGATCTTCGGACTGTAGGAAATTATACATTGGGGCGGCTAATT
GGGAAAGGTTCCTTCGGCAAGGTTTATCTCGCCTCGCATAAGCTCACCAATGGCTCCAAGGTAGGTCATATCATA
CAAAGAAAGTTGTGGGGGCAAGGCTGATCAAGTTCGCAGGTGGTACTCAAATCGTCCAGCAAGGAGGACACCAAT
CTCGTGCGCGAGATCCATCACCATCGCCAATTCCTCCACCCTCATATCGCGCGCCTATACGAAGTGGTGGTAACT
GAGAGCCTCGTTTGGCTTGTGCTAGAGTATTGTCCTGGTACGTCGGCTTGCGCATGGCAGACGCATAGAGAAACA
TACTGACAAAGCTCGGTTCTAGGCGACGAACTTTACAACTACCTCCTTCGACACGGCCCCCTACCGGTAGAGAAG
GTGAAGCGCATATTTACACAGTTGGTTGGAGCGGTCGCCTACGTCCACAGTAAATCCTGTGTGCATCGCGACTTG
AAACTGGAAAACATATTACTGGATAAACAAGAAAACGTCAAGCTTTGCGATTTTGGGTTCACGCGTGAATATGAA
GGCAAGGCTAGCTATCTTCAGACATTCTGCGGGACGATATGCTATAGCGCGCCCGAGATGCTCAAGGGGGAGAAA
TACGCGGGCGAAAAAGTGGATGTATGGAGCTTGGGGATCATTCTATATGCGCTTTTGGCAGGCGAGCTGCCGTTT
GACGACGATGACGACCAAATCACCAAAAAGCGGATTCTGTCGGACGAGCCGACCTTCAACGGAAAGTTCACGGAC
GATGCTAAGGCTCTGGTCAGTCTCCTATTGTCCAAACGGCCTTTGATTCGACCCAGTCTGGATGAGATCCTGGCA
CATCCTTTCCTTGCGGAACATGCTCCTCAACAACTTGCAATCCTGAAAATCCCAAGACCATCGCCATTTACTACG
CCACTGGAGAAGACTACCTTGCAGCGGATGAAAAGCGCTGGGGTCAATATTGACGAGGTTATTGAAAATGTCTTG
GCTCAGCGGTGCGACCCACTGGCTGGCTGGTGGGCCCTACTGATTGAAAAGGAACAAAGGAAGGAAAGAAAGAGA
GAGCGCAAGCGTCGGGAGCGGGATGCTGAAGCAAAAAACATTCGTCGTCTGAGCGCTACCAGCAGTCGCCTAGAA
AAGCGATCATCGGCTTTAATGGAGGTGGAGGAAGAAGGCATGGGGTTGCGCGATCGTGGGAGACGGGATAGAAGA
AGCTTACCATCCCAGTTGGCAGTGCCAGATCTTCCTGCGCTTCCAGAACCGCTCCCTGTATTCCCAATTGAGGTG
ACCACGCCACCATTGCCGCTCGACAAAGATTCTATACGATCCCACAACTCGACGCGACGGCGCCCAGTGCCTCCG
CCAAAAGACAGGCGGCGATCACGGCCCAGCATACTGCATGTTAGCGCATCACAGCCGGAGTTGACACAGCATCAC
GGCATCTTCCGGCGTCGCACTAGTCGTCGTCACCAGTATCCGATACTCAGCCAACTAGCGTCTCTCAAACATTGG
TTTGTAGAGTCGGCGAAAAGAGCGCGGTCTCCCCATGCCAAATCGACGAGCTCGCGGAAGTTTCTTTCTGAAAAG
TTGAGCCCGGCTAAGAGTCAAGATACTGGGAAAACCCCTGCACCTTTAGCGTCCCCAGCAAGCGAGGTCGCAGGG
GAGGATGTTGTTACACCCACCCAGGCAAAACGAGCCTCCAATGCCAGCAGCCTCGCTCCTAGCAGTGCCTCATAC
CGCCAAAACCGCCACTCTTACCCTCACCAGCCGCGCCCATTGAACACCAGTCATAATAGTCATCGAAACTCTCTC
TCGCCCTCACCTATCACCCCACGCGGGTCCTATCGGCGTTCATCGGCCGGGCTCCGAGGTCGCAAATCCACATCC
TCCTCGGTATCATCGATCCGCAGCATTCACCACGCTCGTGCTCACTCCAAGGCCTCTTCGATTTCCTCCAACAGT
GTGGATACTATCTCGACACCCACTGCCAGAGCCTCCAGGTCGCCTCACTCATCTATCAAAGTGCTGCCCACCACT
CCAGGCGCCTCATCCCGCTTTCCGAGCAATATTCGGTTGGTAAGAGGGCCAGGCGGAGCACCTCGAGAGTTCGGT
GACCACTTAGGTCAGATGCCGTCGTCGTTCAACGAAGCGGTACCAGGGCCACTGCTCTACTCACCCTCTTCAAGT
CTGGTGTTTGCAAGGCGAAAGAGATCTCTTTTCAAGGGTCCTATGATCCATACCACCAACTTGATGGTGTCTGGT
GGGATAGCCAACTCCTCTATGCCGGGTCAGCCAATGGATACCAGCGGGCCTGACCTCGCACCAGGGCGGCCTGCT
GCACGCAAGAGCCAAATCATCGAGGAAGAGGAAGATGTCGAAGGAATTGAGGAAGAAATTGAAGAAGTCGATGAG
TTCGAAGAACCTACTACACCAGGAGGTTTCTTTACCCCTGATGAGCAGCCAGCCGAGACCGAATCTCCCTCAAGC
GGCAGAACACCATTTGATCCTATTCTAAACCTTGATACCAGTCCCCTTCGGCCTCCTCGCTCCTCCTCTTTGCGC
TCGCCGTCCGATACCCCAGACAAGATCGGCATCGCCGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail