Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2849.t1
Gene name
Locationscaffold_04:32300..37587
Strand-
Gene length (bp)5287
Transcript length (bp)3960
Coding sequence length (bp)3960
Protein length (aa) 1320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 9.9E-81 375 708
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 1.8E-23 1003 1115
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 2.1E-30 1168 1277
PF10435 BetaGal_dom2 Beta-galactosidase, domain 2 2.5E-54 720 895
PF05368 NmrA NmrA-like family 6.7E-28 5 231
PF13363 BetaGal_dom3 Beta-galactosidase, domain 3 6.7E-23 897 971
PF13460 NAD_binding_10 NAD(P)H-binding 2.1E-08 10 147

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2849.t1
MSRLIVILGITGVQGSSVADAYLVNPGWKIRGVTRNPASDTAKKWEMKGVEMIKGDLDDVASLSEAFVGADIIFG
VTDFWTIFKDPESHQKKKPGQSLVEYCHDVELQQGKNIADAAATVPGLSRYIFSSMAHAKNSSNSKFTELYHMDS
KADAAIYAQSIPALAGKFSQVQAPIYFQLPWEWGLPTTPKKVVDGTWRMTGIGPGDKGIPFGHVRKDFGPCVRAV
AESEPNVNLFAVGEYVSWSDYLRIFCETQGFKYGGYDELSYDKFCELLPGGLGHEFAHNVLFAHEFGYEGIDPAV
VRPEKLGLKMTSFREYCQETDFSALDGDKWRVPVQPPIMRLLTILPILLGLISSHFVSATDNGKTTDVTWDQYSL
SVKGERVYVFSGEFHYQRLPVPELWLDVFQKLRANGFNAISIYFFWNFHSASEDTFDFENGAHDVQRVFDYAKQA
GLYVIARAGPYCNAETSAGGFALWASNGQMGSTRTSASTYYDRWYPWIQKIGKIIAANQITSGGPVILNQHENEL
QETTHSANNTVVKYMEQVKAAFNEAGIVVPSTHNEKGMRSMSWSTDYQDVGGAVNVYGLDSYPGGLSCTNPDTGF
NLVRTYYQWFQNYSSSQPEYLPEFEGGWFSPWGGTFYDQCSTELSPEFADVYYKNNIGSRVTLQNIYMVMGATSW
GHSAAPVVYTSYDYSAPMRETREIRDKLKQTKLIGLFTRVSSGLLQMQMEGNGTGYTSDAGIYTWALRNPETQAG
FYVLAHSTSSSRAVTTTSLNVNTSAGALTIPNIELAGRQSKIIVTDYRIGQGSSLLYSSAEVLTYATLDIDVIVF
YLNIGQKGEFVFKDAPTHLTFQTYGNSKVNSGASNHGTKYTYTQGDGTTVLKFSHGVLVYLLDKETAWNFFAVPT
TSNPNVVPSEQIIALGPYLVRTATVSGDTVSLVGDNANTTSIEVYTGNSKVTKIKWNGKEISTKKTPYGSLIGSA
PGAQAKVSLPTLKSWKAQDTLPEIKADYDDSRWTICNKTRSVNSVAPLTLPVLYSGDYGYHAGTRIYRGRFDGMT
ATGANLTVQNGAAAGWAAWLNGVYVGGAIGDPTLAATSAELLFNSATLRKTDNVLTVIMDYTGHDEANVSPNGAQ
NPRGILGATLLGGEFTSWRIQGNAGGEANIDPVRGPMNEGGLYGERLGWHLPGYKAPKTATSHSPLDGISGAAGR
FYTTTFQLDLDSDLDVPIGLQLDASADFPAVVQIFMNGYQFGHYLPHIGPQTRFPFPPGVINNRGENTLAMSLWA
LTDRGARLSQVDLVAYGAYRTGFNFNHDWSYLQPQWKNNREQYV*
Coding >Pro_DTO377G3_2|g2849.t1
ATGTCGCGACTTATTGTGATCCTCGGTATTACGGGTGTGCAAGGAAGCTCCGTCGCCGACGCTTACCTTGTGAAT
CCGGGCTGGAAGATTCGCGGTGTGACGCGCAATCCGGCATCTGATACTGCAAAGAAATGGGAGATGAAAGGTGTT
GAAATGATCAAAGGTGACCTTGATGATGTGGCATCCTTGAGCGAGGCCTTTGTGGGAGCCGACATTATTTTTGGT
GTCACCGACTTCTGGACAATCTTCAAAGATCCAGAAAGTCACCAGAAGAAGAAGCCCGGCCAATCACTTGTGGAA
TATTGCCACGATGTCGAGCTCCAACAGGGCAAGAATATTGCCGATGCTGCGGCCACTGTTCCTGGCCTATCCCGA
TACATCTTCAGCTCAATGGCCCATGCGAAGAATTCCAGTAACAGCAAGTTCACCGAACTTTATCACATGGATTCT
AAAGCAGACGCTGCCATCTACGCACAGAGCATCCCGGCCCTGGCTGGAAAATTCTCGCAGGTTCAGGCGCCCATA
TATTTCCAGCTCCCTTGGGAGTGGGGACTTCCTACAACCCCGAAGAAGGTAGTTGATGGCACCTGGCGAATGACA
GGAATTGGCCCAGGTGACAAGGGCATTCCGTTCGGGCATGTCCGCAAGGATTTCGGCCCTTGCGTCAGGGCAGTT
GCAGAGTCCGAGCCCAATGTCAATTTATTTGCTGTTGGTGAATATGTATCGTGGTCAGATTACCTCCGCATCTTT
TGCGAAACCCAAGGTTTCAAGTATGGTGGCTACGACGAGCTTTCCTACGATAAATTCTGCGAGTTGCTTCCCGGA
GGTCTTGGTCACGAATTTGCTCACAATGTATTATTTGCACATGAGTTCGGGTACGAAGGTATCGATCCTGCTGTT
GTACGACCAGAGAAGCTTGGTCTGAAAATGACCTCGTTCCGTGAATATTGCCAAGAGACTGATTTCTCGGCACTG
GACGGTGACAAATGGAGAGTACCTGTGCAGCCCCCAATAATGCGTCTTCTCACGATTCTCCCTATACTCCTTGGA
CTCATATCCAGCCATTTCGTCTCTGCGACAGATAATGGCAAGACTACTGATGTGACATGGGATCAATACAGCCTC
TCAGTTAAAGGAGAGAGGGTATATGTGTTCTCTGGTGAATTCCACTACCAGCGACTCCCCGTGCCGGAGCTTTGG
CTCGACGTATTTCAGAAGCTACGCGCAAATGGATTCAATGCGATTTCTATCTACTTCTTCTGGAATTTCCACTCC
GCTTCCGAAGATACTTTCGACTTCGAGAACGGTGCCCACGACGTCCAGCGCGTCTTTGATTATGCCAAGCAGGCA
GGTCTGTATGTGATTGCGCGCGCGGGACCTTACTGCAATGCTGAGACCTCTGCTGGTGGTTTCGCACTGTGGGCA
TCCAATGGGCAAATGGGCAGCACGCGCACGAGCGCAAGCACCTACTATGACCGATGGTATCCGTGGATCCAGAAG
ATCGGAAAGATCATCGCCGCAAACCAAATCACAAGCGGTGGTCCGGTCATTCTCAATCAGCACGAGAATGAGTTG
CAGGAGACAACACACAGTGCCAATAACACTGTTGTCAAGTACATGGAACAAGTTAAAGCCGCCTTCAATGAGGCT
GGTATCGTTGTCCCGAGCACGCATAATGAGAAGGGAATGCGCTCTATGAGCTGGTCGACGGACTACCAGGATGTG
GGTGGTGCCGTCAATGTCTATGGTTTGGACTCCTATCCTGGTGGTCTGTCCTGTACCAATCCAGATACTGGGTTC
AATCTCGTCCGCACTTATTACCAATGGTTCCAGAATTACTCGAGTTCTCAGCCCGAGTATCTGCCGGAGTTTGAG
GGCGGTTGGTTCTCCCCCTGGGGAGGGACGTTCTACGATCAATGTTCTACCGAGCTTTCGCCTGAATTCGCCGAT
GTCTACTATAAGAATAATATCGGCTCCAGAGTCACATTGCAGAATATATATATGGTGATGGGGGCAACTTCTTGG
GGCCACAGTGCTGCTCCGGTTGTCTATACTTCATATGACTACTCTGCGCCCATGCGAGAGACGCGTGAGATTCGG
GACAAACTCAAGCAGACCAAGTTGATCGGTCTGTTTACGCGCGTGTCATCTGGTCTTTTACAAATGCAAATGGAA
GGGAATGGAACAGGGTACACCAGTGATGCGGGTATATATACGTGGGCCTTGCGAAACCCAGAAACCCAAGCCGGT
TTCTATGTTCTCGCGCACTCTACCAGCTCATCTCGTGCTGTGACCACTACTTCACTTAATGTCAATACATCGGCT
GGGGCCCTGACAATCCCTAATATTGAGTTGGCCGGCCGTCAGAGCAAAATTATCGTCACTGACTACCGGATTGGC
CAGGGCTCGAGCTTGCTCTATTCATCCGCCGAGGTCTTGACCTACGCCACCCTCGACATAGATGTTATTGTCTTC
TATCTGAATATCGGACAAAAAGGAGAGTTTGTATTCAAAGACGCACCGACCCATCTGACTTTCCAAACTTACGGG
AATTCGAAAGTCAACTCTGGTGCATCGAATCATGGCACGAAATACACATACACTCAAGGGGATGGCACGACAGTG
CTGAAATTCTCGCACGGCGTACTGGTCTACCTTCTTGATAAGGAGACAGCGTGGAACTTCTTTGCAGTACCGACT
ACTTCCAATCCGAATGTGGTTCCCAGTGAGCAGATCATTGCCCTTGGGCCATATCTCGTTCGCACAGCAACTGTC
AGTGGGGATACTGTCAGTCTTGTTGGTGACAACGCAAACACAACATCTATTGAGGTCTACACGGGCAACTCAAAG
GTGACCAAAATCAAGTGGAATGGCAAAGAGATCTCAACCAAGAAGACACCATACGGCAGCTTAATCGGATCAGCC
CCGGGAGCCCAAGCCAAAGTATCGCTGCCGACTCTGAAATCATGGAAAGCGCAAGATACCCTTCCGGAGATTAAG
GCAGACTACGATGATTCTCGCTGGACCATCTGCAACAAAACGAGATCAGTCAACTCTGTGGCACCACTCACACTT
CCCGTGCTTTACTCTGGCGACTACGGCTACCATGCCGGAACGAGAATATATCGCGGACGGTTCGATGGCATGACC
GCGACAGGCGCAAATCTCACTGTCCAGAACGGCGCAGCCGCTGGTTGGGCCGCCTGGCTAAACGGAGTCTACGTT
GGCGGAGCCATTGGTGATCCGACCCTAGCCGCGACATCAGCCGAGCTACTATTCAACAGCGCTACCTTGCGCAAG
ACAGACAATGTTCTGACCGTTATCATGGATTACACAGGCCACGACGAGGCGAACGTGTCGCCAAACGGAGCACAA
AACCCGCGTGGTATACTAGGCGCGACGCTTCTTGGTGGCGAATTCACTTCCTGGCGTATCCAAGGCAATGCAGGA
GGCGAAGCCAACATCGATCCCGTCCGGGGACCCATGAACGAAGGGGGTCTCTATGGAGAGCGTCTCGGTTGGCAT
CTCCCAGGATACAAAGCGCCCAAGACCGCAACCTCGCACAGTCCGCTGGACGGCATATCTGGTGCAGCAGGCCGG
TTCTACACGACGACGTTCCAGCTCGACCTGGACTCCGACCTGGACGTTCCGATTGGTCTGCAGCTCGATGCATCT
GCTGATTTCCCCGCAGTAGTCCAGATCTTCATGAATGGGTACCAGTTCGGTCATTACCTGCCACACATCGGTCCC
CAGACTAGGTTCCCTTTTCCACCTGGCGTGATCAATAACCGTGGGGAGAACACGTTGGCGATGAGTCTGTGGGCG
CTGACGGACCGAGGGGCGAGACTGAGTCAGGTGGATCTGGTTGCATATGGGGCTTATCGTACAGGATTCAACTTC
AATCACGATTGGTCATACCTGCAGCCACAATGGAAGAACAACCGGGAGCAATATGTGTAG
Transcript >Pro_DTO377G3_2|g2849.t1
ATGTCGCGACTTATTGTGATCCTCGGTATTACGGGTGTGCAAGGAAGCTCCGTCGCCGACGCTTACCTTGTGAAT
CCGGGCTGGAAGATTCGCGGTGTGACGCGCAATCCGGCATCTGATACTGCAAAGAAATGGGAGATGAAAGGTGTT
GAAATGATCAAAGGTGACCTTGATGATGTGGCATCCTTGAGCGAGGCCTTTGTGGGAGCCGACATTATTTTTGGT
GTCACCGACTTCTGGACAATCTTCAAAGATCCAGAAAGTCACCAGAAGAAGAAGCCCGGCCAATCACTTGTGGAA
TATTGCCACGATGTCGAGCTCCAACAGGGCAAGAATATTGCCGATGCTGCGGCCACTGTTCCTGGCCTATCCCGA
TACATCTTCAGCTCAATGGCCCATGCGAAGAATTCCAGTAACAGCAAGTTCACCGAACTTTATCACATGGATTCT
AAAGCAGACGCTGCCATCTACGCACAGAGCATCCCGGCCCTGGCTGGAAAATTCTCGCAGGTTCAGGCGCCCATA
TATTTCCAGCTCCCTTGGGAGTGGGGACTTCCTACAACCCCGAAGAAGGTAGTTGATGGCACCTGGCGAATGACA
GGAATTGGCCCAGGTGACAAGGGCATTCCGTTCGGGCATGTCCGCAAGGATTTCGGCCCTTGCGTCAGGGCAGTT
GCAGAGTCCGAGCCCAATGTCAATTTATTTGCTGTTGGTGAATATGTATCGTGGTCAGATTACCTCCGCATCTTT
TGCGAAACCCAAGGTTTCAAGTATGGTGGCTACGACGAGCTTTCCTACGATAAATTCTGCGAGTTGCTTCCCGGA
GGTCTTGGTCACGAATTTGCTCACAATGTATTATTTGCACATGAGTTCGGGTACGAAGGTATCGATCCTGCTGTT
GTACGACCAGAGAAGCTTGGTCTGAAAATGACCTCGTTCCGTGAATATTGCCAAGAGACTGATTTCTCGGCACTG
GACGGTGACAAATGGAGAGTACCTGTGCAGCCCCCAATAATGCGTCTTCTCACGATTCTCCCTATACTCCTTGGA
CTCATATCCAGCCATTTCGTCTCTGCGACAGATAATGGCAAGACTACTGATGTGACATGGGATCAATACAGCCTC
TCAGTTAAAGGAGAGAGGGTATATGTGTTCTCTGGTGAATTCCACTACCAGCGACTCCCCGTGCCGGAGCTTTGG
CTCGACGTATTTCAGAAGCTACGCGCAAATGGATTCAATGCGATTTCTATCTACTTCTTCTGGAATTTCCACTCC
GCTTCCGAAGATACTTTCGACTTCGAGAACGGTGCCCACGACGTCCAGCGCGTCTTTGATTATGCCAAGCAGGCA
GGTCTGTATGTGATTGCGCGCGCGGGACCTTACTGCAATGCTGAGACCTCTGCTGGTGGTTTCGCACTGTGGGCA
TCCAATGGGCAAATGGGCAGCACGCGCACGAGCGCAAGCACCTACTATGACCGATGGTATCCGTGGATCCAGAAG
ATCGGAAAGATCATCGCCGCAAACCAAATCACAAGCGGTGGTCCGGTCATTCTCAATCAGCACGAGAATGAGTTG
CAGGAGACAACACACAGTGCCAATAACACTGTTGTCAAGTACATGGAACAAGTTAAAGCCGCCTTCAATGAGGCT
GGTATCGTTGTCCCGAGCACGCATAATGAGAAGGGAATGCGCTCTATGAGCTGGTCGACGGACTACCAGGATGTG
GGTGGTGCCGTCAATGTCTATGGTTTGGACTCCTATCCTGGTGGTCTGTCCTGTACCAATCCAGATACTGGGTTC
AATCTCGTCCGCACTTATTACCAATGGTTCCAGAATTACTCGAGTTCTCAGCCCGAGTATCTGCCGGAGTTTGAG
GGCGGTTGGTTCTCCCCCTGGGGAGGGACGTTCTACGATCAATGTTCTACCGAGCTTTCGCCTGAATTCGCCGAT
GTCTACTATAAGAATAATATCGGCTCCAGAGTCACATTGCAGAATATATATATGGTGATGGGGGCAACTTCTTGG
GGCCACAGTGCTGCTCCGGTTGTCTATACTTCATATGACTACTCTGCGCCCATGCGAGAGACGCGTGAGATTCGG
GACAAACTCAAGCAGACCAAGTTGATCGGTCTGTTTACGCGCGTGTCATCTGGTCTTTTACAAATGCAAATGGAA
GGGAATGGAACAGGGTACACCAGTGATGCGGGTATATATACGTGGGCCTTGCGAAACCCAGAAACCCAAGCCGGT
TTCTATGTTCTCGCGCACTCTACCAGCTCATCTCGTGCTGTGACCACTACTTCACTTAATGTCAATACATCGGCT
GGGGCCCTGACAATCCCTAATATTGAGTTGGCCGGCCGTCAGAGCAAAATTATCGTCACTGACTACCGGATTGGC
CAGGGCTCGAGCTTGCTCTATTCATCCGCCGAGGTCTTGACCTACGCCACCCTCGACATAGATGTTATTGTCTTC
TATCTGAATATCGGACAAAAAGGAGAGTTTGTATTCAAAGACGCACCGACCCATCTGACTTTCCAAACTTACGGG
AATTCGAAAGTCAACTCTGGTGCATCGAATCATGGCACGAAATACACATACACTCAAGGGGATGGCACGACAGTG
CTGAAATTCTCGCACGGCGTACTGGTCTACCTTCTTGATAAGGAGACAGCGTGGAACTTCTTTGCAGTACCGACT
ACTTCCAATCCGAATGTGGTTCCCAGTGAGCAGATCATTGCCCTTGGGCCATATCTCGTTCGCACAGCAACTGTC
AGTGGGGATACTGTCAGTCTTGTTGGTGACAACGCAAACACAACATCTATTGAGGTCTACACGGGCAACTCAAAG
GTGACCAAAATCAAGTGGAATGGCAAAGAGATCTCAACCAAGAAGACACCATACGGCAGCTTAATCGGATCAGCC
CCGGGAGCCCAAGCCAAAGTATCGCTGCCGACTCTGAAATCATGGAAAGCGCAAGATACCCTTCCGGAGATTAAG
GCAGACTACGATGATTCTCGCTGGACCATCTGCAACAAAACGAGATCAGTCAACTCTGTGGCACCACTCACACTT
CCCGTGCTTTACTCTGGCGACTACGGCTACCATGCCGGAACGAGAATATATCGCGGACGGTTCGATGGCATGACC
GCGACAGGCGCAAATCTCACTGTCCAGAACGGCGCAGCCGCTGGTTGGGCCGCCTGGCTAAACGGAGTCTACGTT
GGCGGAGCCATTGGTGATCCGACCCTAGCCGCGACATCAGCCGAGCTACTATTCAACAGCGCTACCTTGCGCAAG
ACAGACAATGTTCTGACCGTTATCATGGATTACACAGGCCACGACGAGGCGAACGTGTCGCCAAACGGAGCACAA
AACCCGCGTGGTATACTAGGCGCGACGCTTCTTGGTGGCGAATTCACTTCCTGGCGTATCCAAGGCAATGCAGGA
GGCGAAGCCAACATCGATCCCGTCCGGGGACCCATGAACGAAGGGGGTCTCTATGGAGAGCGTCTCGGTTGGCAT
CTCCCAGGATACAAAGCGCCCAAGACCGCAACCTCGCACAGTCCGCTGGACGGCATATCTGGTGCAGCAGGCCGG
TTCTACACGACGACGTTCCAGCTCGACCTGGACTCCGACCTGGACGTTCCGATTGGTCTGCAGCTCGATGCATCT
GCTGATTTCCCCGCAGTAGTCCAGATCTTCATGAATGGGTACCAGTTCGGTCATTACCTGCCACACATCGGTCCC
CAGACTAGGTTCCCTTTTCCACCTGGCGTGATCAATAACCGTGGGGAGAACACGTTGGCGATGAGTCTGTGGGCG
CTGACGGACCGAGGGGCGAGACTGAGTCAGGTGGATCTGGTTGCATATGGGGCTTATCGTACAGGATTCAACTTC
AATCACGATTGGTCATACCTGCAGCCACAATGGAAGAACAACCGGGAGCAATATGTGTAG
Gene >Pro_DTO377G3_2|g2849.t1
ATGTCGCGACTTATTGTGATCCTCGGTATTACGGGTGTGCAAGTAAGTTAGAATCGCTCCCTGTACAATTTCTTT
GGATATTGCCTGAGGTTACTAACACCAAAGCTGAAGGGAAGCTCCGTCGCCGACGCTTACCTTGTGAATCCGGGC
TGGAAGATTCGCGGTGTGACGCGCAATCCGGCATCTGATACTGCAAAGAAATGGGAGATGAAAGGTGTTGAAATG
ATCAAAGGTGACCTTGATGATGTGGCATCCTTGAGCGAGGCCTTTGTGGGAGCCGACATTATTTTTGGTGTCACC
GACTTCTGGACAATCTTCAAAGATCCAGAAAGTCACCAGAAGAAGAAGCCCGGCCAATCACTTGTGGAATATTGC
CACGATGTCGAGCTCCAACAGGGCAAGAATATTGCCGATGCTGCGGCCACTGTTCCTGGCCTATCCCGATACATC
TTCAGCTCAATGGCCCATGCGAAGAATTCCAGTAACAGCAAGTTCACCGAACTTTATCACATGGATTCTAAAGCA
GACGCTGCCATCTACGCACAGAGCATCCCGGCCCTGGCTGGAAAATTCTCGCAGGTTCAGGCGCCCATATATTTC
CAGCTCCCTTGGGAGTGGGGACTTCCTACAACCCCGAAGAAGGTATGAATCATGAAATCGCCCCGCCAGGACTTT
TGTTTTTTTTTCGTAATTCCCGGGCGTATTTTGAAGGTATTGACTCGTTGCATAGGTAGTTGATGGCACCTGGCG
AATGACAGGAATTGGCCCAGGTGACAAGGGCATTCCGTTCGGGCATGTCCGCAAGGATTTCGGCCCTTGCGTCAG
GGCAGTTGCAGAGTCCGAGCCCAATGTCAATTTATTTGCTGTTGGTGAATATGTATCGTGGTCAGATTACCTCCG
CATCTTTTGCGAAACCCAAGGTTTCAAGTATGGTGGCTACGACGAGCTTTCCTACGATAAATTCTGCGAGTTGCT
TCCCGGAGGTCTTGGTCACGAATTTGCTCACAATGTATTATTTGCACATGAGTTCGGGTACGAAGGTATCGATCC
TGCTGTTGTACGACCAGAGAAGGTATGTTATCCTATTCGATCTCGTTGCCACTCTGGGACATGACTGACCTTTCT
ATAGCTTGGTCTGAAAATGACCTCGTTCCGTGAATATTGCCAAGAGACTGATTTCTCGGCACTGGACGGTGACAA
GTGAGGCATTCAATGGGGAAGCTCTCGGTCAGCTGAGATCTGTCTCAGCTATGAGTAAACAGTAGTGTCAGGGGC
CATAGGAGTCAACTCAATCGATATCTCTTCTGGGGTCCAACTACAGCCGATAATATCATCTCATAAGCTCAAATA
TCCTCTATCCTAAAGTGTCGGTCTAAACCGCATGTGTAATATATAATATTACGCGCCGATGCTTTATGAAAAAGA
GTACATTCTAACTAGAACATCGAACATGGGGGGGAAAGGAAAGGAATCAGGGCCATTGTGAGTTTTGTACCCTTC
TCCTTGCCAGGCAAAATCTAGTATACTCTCCTACAGCTTAGGAAGGAACGATCCCTATAGAGAAGGAAGGAGCCA
ACGAGCCAACGACATAAGAAAAGAACTACCAAGCCTTGATCGTAACATAACCGCCCAAAAGTGCGTTCAGTCCCT
GAGGGTTGGATATTTCCCGCAACTATGTAGAGACGGTATTGTGGAATACGAGACTTGGCGAGTTGAATAGTGGCA
TAGCATCTTTTCGTTGAGGGAACAACGGTCAAGAGTGGGCTTGAGTTCTGGTGAATAACTGCATTTGGATGCTAG
CGTGGTGCATTTTATTGAGCAAGTCCGTGAGCTTATGTAATACTCAGCGACGTGCTCAGTTGTCCTCAGTGAGCA
AAAAGCGGCAAGGACTGAGCACTAAGACGGAAAGGGAAAGCCAAGAAGTGGCAGAGGAAATCAAGTACAGACGCA
TATTTGTATATCTGTATTCAATGTCCAAAATTCATTCAGAACCACCTGTCCCTAGTCAAAAGCCGATCATTCCCC
CGCATCTTCATGGAAAATTGCCTAATCCGACATTCGATCTCCAAAACAAAACATCCACCAATCCCAGCAGAGTAC
GGGGTATTTCTGTAGCGAGGACCGAAGCATACACACATTATAACAAGTCATATTCCAAGATGGAGAGTACCTGTG
CAGCCCCCAATAATGCGTCTTCTCACGATTCTCCCTATACTCCTTGGACTCATATCCAGCCATTTCGTCTCTGCG
ACAGATAATGGCAAGACTACTGATGTGACATGGGATCAATACAGCCTCTCAGTTAAAGGAGAGAGGGTATATGTG
TTCTCTGGTGAATTCCACTACCAGCGACTCCCCGTGCCGGAGCTTTGGCTCGACGTATTTCAGAAGCTACGCGCA
AATGGATTCAATGCGATTTCTAGTGAGTGGCTTGACAACACCCAGGCTGCACTGGTACTCATTGAGACTAGTCTA
CTTCTTCTGGAATTTCCACTCCGCTTCCGAAGATACTTTCGACTTCGAGAACGGTGCCCACGACGTCCAGCGCGT
CTTTGATTATGCCAAGCAGGCAGGTCTGTATGTGATTGCGCGCGCGGGACCTTACTGCAATGCTGAGACCTCTGC
TGGTGGTTTCGCACTGTGGGCATCCAATGGGCAAATGGGCAGCACGCGCACGAGCGCAAGCACCTACTATGACCG
ATGGTATCCGTGGATCCAGAAGATCGGAAAGATCATCGCCGCAAACCAAATCACAAGCGGTGGTCCGGTCATTCT
CAATCAGCACGAGAATGAGTTGCAGGAGACAACACACAGTGCCAATAACACTGTTGTCAAGTACATGGAACAAGT
TAAAGCCGCCTTCAATGAGGCTGGTATCGTTGTCCCGAGCACGCATAATGAGAAGGGAATGCGCTCTATGAGCTG
GTCGACGGACTACCAGGATGTGGGTGGTGCCGTCAATGTCTATGGTTTGGACTCCTATCCTGGTGGTCTGTCCTG
TACCAATCCAGATACTGGGTTCAATCTCGTCCGCACTTATTACCAATGGTTCCAGAATTACTCGAGTTCTCAGCC
CGAGTATCTGCCGGAGTTTGAGGGCGGTTGGTTCTCCCCCTGGGGAGGGACGTTCTACGATCAATGTTCTACCGA
GCTTTCGCCTGAATTCGCCGATGTCTACTATAAGAATAATATCGGCTCCAGAGTCACATTGCAGAATATATATAT
GGTGATGGGGGCAACTTCTTGGGGCCACAGTGCTGCTCCGGTTGTCTATACTTCATATGACTACTCTGCGCCCAT
GCGAGAGACGCGTGAGATTCGGGACAAACTCAAGCAGACCAAGTTGATCGGTCTGTTTACGCGCGTGTCATCTGG
TCTTTTACAAATGCAAATGGAAGGGAATGGAACAGGGTACACCAGTGATGCGGGTATATATACGTGGGCCTTGCG
AAACCCAGAAACCCAAGCCGGTTTCTATGTTCTCGCGCACTCTACCAGCTCATCTCGTGCTGTGACCACTACTTC
ACTTAATGTCAATACATCGGCTGGTACGTACTCCAGTGTTTGAGAGGAATAATTGCGCTAACTTGAATTCTACAC
GACAGGGGCCCTGACAATCCCTAATATTGAGTTGGCCGGCCGTCAGAGCAAAATTATCGTCACTGACTACCGGAT
TGGCCAGGGCTCGAGCTTGCTCTATTCATCCGCCGAGGTCTTGACCTACGCCACCCTCGACATAGATGTTATTGT
CTTCTATCTGAATATCGGACAAAAAGGAGAGTTTGTATTCAAAGACGCACCGACCCATCTGACTTTCCAAACTTA
CGGGAATTCGAAAGTCAACTCTGGTGCATCGAATCATGGCACGAAATACACATACACTCAAGGGGATGGCACGAC
AGTGCTGAAATTCTCGCACGGCGTACTGGTCTACCTTCTTGATAAGGAGACAGCGTGGAACTTCTTTGCAGTACC
GACTACTTCCAATCCGAATGTGGTTCCCAGTGAGCAGATCATTGCCCTTGGGCCATATCTCGTTCGCACAGCAAC
TGTCAGTGGGGATACTGTCAGTCTTGTTGGTGACAACGCAAACACAACATCTATTGAGTAAGCGCGAAGCTCTCA
AATAATTTACTCGCTAATATATGCTGTTAGGGTCTACACGGGCAACTCAAAGGTGACCAAAATCAAGTGGAATGG
CAAAGAGATCTCAACCAAGAAGACACCATACGGCAGCTTAATCGGATCAGCCCCGGGAGCCCAAGCCAAAGTATC
GCTGCCGACTCTGAAATCATGGAAAGCGCAAGATACCCTTCCGGAGATTAAGGCAGACTACGATGATTCTCGCTG
GACCATCTGCAACAAAACGAGATCAGTCAACTCTGTGGCACCACTCACACTTCCCGTGCTTTACTCTGGCGACTA
CGGCTACCATGCCGGAACGAGAATATATCGCGGACGGTTCGATGGCATGACCGCGACAGGCGCAAATCTCACTGT
CCAGAACGGCGCAGCCGCTGGTTGGGCCGCCTGGCTAAACGGAGTCTACGTTGGCGGAGCCATTGGTGATCCGAC
CCTAGCCGCGACATCAGCCGAGCTACTATTCAACAGCGCTACCTTGCGCAAGACAGACAATGTTCTGACCGTTAT
CATGGATTACACAGGCCACGACGAGGCGAACGTGTCGCCAAACGGAGCACAAAACCCGCGTGGTATACTAGGCGC
GACGCTTCTTGGTGGCGAATTCACTTCCTGGCGTATCCAAGGCAATGCAGGAGGCGAAGCCAACATCGATCCCGT
CCGGGGACCCATGAACGAAGGGGGTCTCTATGGAGAGCGTCTCGGTTGGCATCTCCCAGGATACAAAGCGCCCAA
GACCGCAACCTCGCACAGTCCGCTGGACGGCATATCTGGTGCAGCAGGCCGGTTCTACACGACGACGTTCCAGCT
CGACCTGGACTCCGACCTGGACGTTCCGATTGGTCTGCAGCTCGATGCATCTGCTGATTTCCCCGCAGTAGTCCA
GATCTTCATGAATGGGTACCAGTTCGGTCATTACCTGCCACACATCGGTCCCCAGACTAGGTTCCCTTTTCCACC
TGGCGTGATCAATAACCGTGGGGAGAACACGTTGGCGATGAGTCTGTGGGCGCTGACGGACCGAGGGGCGAGACT
GAGTCAGGTGGATCTGGTTGCATATGGGGCTTATCGTACAGGATTCAACTTCAATCACGATTGGTCATACCTGCA
GCCACAATGGAAGAACAACCGGGAGCAATATGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail