Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2841.t1
Gene name
Locationscaffold_04:20096..21128
Strand-
Gene length (bp)1032
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03332 PMM Eukaryotic phosphomannomutase 1.4E-100 40 267

GO

GO Term Description Terminal node
GO:0009298 GDP-mannose biosynthetic process Yes
GO:0005737 cytoplasm Yes
GO:0004615 phosphomannomutase activity Yes
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044464 cell part No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016868 intramolecular transferase activity, phosphotransferases No
GO:0016853 isomerase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0009225 nucleotide-sugar metabolic process No
GO:0008150 biological_process No
GO:0044424 intracellular part No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0044281 small molecule metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0019673 GDP-mannose metabolic process No
GO:0009226 nucleotide-sugar biosynthetic process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2841.t1
MTEATSVYPSLEDRPMKNTIVLFDVDETLTPARRHASPEMLELLSRLRHKCAIGYVGGSNLVKQQEQLGSATMDV
TTMFDFCFSENGLTAFRLGKPLATNNFIQWLGEDKYQTLVDFILKFIANTKLPRKRGTFVEFRNGMVNVSPVGRA
ASTDERAEFEAFDKIHNIRKTLVEALRKEFPDYGLTYSIGGQISFDVFPTGWDKTYCLQHVEAEKGISGVDYKTI
HFFGDKTCVGGNDYEIYEDPRTIGHAVTGPDDTIKQMKKLFDL*
Coding >Pro_DTO377G3_2|g2841.t1
ATGACTGAAGCTACCAGTGTTTACCCCTCGTTGGAGGACCGTCCCATGAAGAACACGATTGTTCTGTTCGATGTT
GACGAGACTCTCACCCCCGCAAGACGGCATGCCTCGCCAGAGATGCTCGAGTTGCTCTCTCGGTTGCGCCACAAA
TGCGCCATTGGATACGTTGGCGGCTCGAACCTTGTGAAGCAGCAAGAACAACTTGGATCAGCCACCATGGATGTC
ACCACCATGTTCGATTTCTGCTTCTCCGAAAACGGCCTGACCGCATTCCGCCTCGGCAAGCCGCTTGCTACCAAC
AACTTCATCCAGTGGCTTGGGGAGGACAAGTACCAAACACTGGTGGATTTCATTCTTAAATTTATTGCCAACACC
AAGTTGCCTCGCAAGCGCGGTACTTTCGTTGAGTTCCGTAATGGAATGGTTAATGTTAGCCCTGTTGGACGTGCT
GCTAGCACCGACGAGCGTGCTGAGTTCGAAGCTTTCGACAAGATTCACAACATCAGAAAGACCCTAGTGGAGGCC
TTGAGGAAGGAGTTCCCCGACTACGGTCTCACCTACTCTATCGGCGGTCAGATCTCTTTCGATGTCTTCCCTACC
GGTTGGGATAAGACCTACTGCCTACAGCACGTCGAAGCTGAAAAGGGCATCTCGGGTGTCGACTACAAGACCATC
CACTTCTTCGGCGACAAGACTTGCGTCGGAGGAAACGATTATGAGATCTACGAGGACCCTCGCACCATTGGGCAT
GCCGTTACTGGTCCTGACGACACCATCAAGCAGATGAAGAAGCTGTTTGACTTATAG
Transcript >Pro_DTO377G3_2|g2841.t1
ATGACTGAAGCTACCAGTGTTTACCCCTCGTTGGAGGACCGTCCCATGAAGAACACGATTGTTCTGTTCGATGTT
GACGAGACTCTCACCCCCGCAAGACGGCATGCCTCGCCAGAGATGCTCGAGTTGCTCTCTCGGTTGCGCCACAAA
TGCGCCATTGGATACGTTGGCGGCTCGAACCTTGTGAAGCAGCAAGAACAACTTGGATCAGCCACCATGGATGTC
ACCACCATGTTCGATTTCTGCTTCTCCGAAAACGGCCTGACCGCATTCCGCCTCGGCAAGCCGCTTGCTACCAAC
AACTTCATCCAGTGGCTTGGGGAGGACAAGTACCAAACACTGGTGGATTTCATTCTTAAATTTATTGCCAACACC
AAGTTGCCTCGCAAGCGCGGTACTTTCGTTGAGTTCCGTAATGGAATGGTTAATGTTAGCCCTGTTGGACGTGCT
GCTAGCACCGACGAGCGTGCTGAGTTCGAAGCTTTCGACAAGATTCACAACATCAGAAAGACCCTAGTGGAGGCC
TTGAGGAAGGAGTTCCCCGACTACGGTCTCACCTACTCTATCGGCGGTCAGATCTCTTTCGATGTCTTCCCTACC
GGTTGGGATAAGACCTACTGCCTACAGCACGTCGAAGCTGAAAAGGGCATCTCGGGTGTCGACTACAAGACCATC
CACTTCTTCGGCGACAAGACTTGCGTCGGAGGAAACGATTATGAGATCTACGAGGACCCTCGCACCATTGGGCAT
GCCGTTACTGGTCCTGACGACACCATCAAGCAGATGAAGAAGCTGTTTGACTTATAG
Gene >Pro_DTO377G3_2|g2841.t1
ATGACTGAAGCTACCAGTGTTTACCCCTCGTTGGAGGACCGTCCCATGAAGAACACGATTGTTCTGTTCGATGTT
GACGAGACTCTCACCCCCGCAAGACGGGTACGTTGCACTGAGACTCCTTGTTGTTCAATTATACTAACGAATTCT
ATTACAGCATGCCTCGCCAGAGATGCTCGAGTTGCTCTCTCGGTTGCGCCACAAATGCGCCATTGGATACGTTCG
TCTCCTCCCAATCAATACCCCCACCCCGTTCCTAACATGATGTAGGTTGGCGGCTCGAACCTTGTGAAGCAGCAA
GAACAACTTGGATCAGCCACCATGGATGTCACCACCATGTTCGATTTCTGCTTCTCCGAAAACGGCCTGACCGCA
TTCCGCCTCGGCAAGCCGCTTGCTACCAACAACTTCATCCAGTGGCTTGGGGAGGACAAGTACCAAACACTGGTG
GATTTCATTCTTAAATTTATTGCCAACACCAAGTTGCCTCGCAAGCGCGGTACTTTCGTTGAGTTCCGTAATGGA
ATGGTTAATGTTAGCCCTGTTGGACGTGCTGCTAGCACCGACGAGCGTGCTGAGTTCGAAGCGTACGGGCTGATC
TTCTATATGTCCACATAAATGGACTGCCTGACTGACCTATGCTATAGTTTCGACAAGATTCACAACATCAGAAAG
ACCCTAGTGGAGGCCTTGAGGAAGGAGTTCCCCGACTACGGTCTCACGTAAGTCTTTGTCCGGCAAGGTTTACTT
TTAATATGGTACTAATCAATCTACTAATATAGCTACTCTATCGGCGGTCAGATCTCTTTCGATGTCTTCCCTACC
GGTTGGGATAAGACCTACTGCCTACAGCACGTCGAAGCTGAAAAGGGCATCTCGGGTGTCGACTACAAGACCATC
CACTTCTTCGGCGACAAGACTTGCGTCGGAGGAAACGATTATGAGATCTACGAGGACCCTCGCACCATTGGGCAT
GCCGTTACTGGTCCTGACGACACCATCAAGCAGATGAAGAAGCTGTTTGACTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail