Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g283.t1
Gene name
Locationscaffold_01:720866..722826
Strand-
Gene length (bp)1960
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 8.3E-33 23 191
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 1.9E-08 199 293
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 2.0E-05 23 105

GO

GO Term Description Terminal node
GO:0003857 3-hydroxyacyl-CoA dehydrogenase activity Yes
GO:0006631 fatty acid metabolic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0051287 NAD binding Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0046168 glycerol-3-phosphate catabolic process Yes
GO:0052646 alditol phosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:1901575 organic substance catabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0006796 phosphate-containing compound metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0044237 cellular metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0050662 coenzyme binding No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0006072 glycerol-3-phosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0048037 cofactor binding No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0036094 small molecule binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g283.t1
MNTLRRSMASHWVPPSNYRNRPVTILGAGVLGRRIGCIWASAGYDVRIRDPSSQQRADGIAYIQENVQSYAAKTK
QIPGSFEAFEDMKKAVENAWLVIEAVPEKLELKISTFAELEALAPEDCILASNSSSYKSSEIISQISDATKKRVL
NMHYYMPPSCMIVELMTDGHTAPEIFPFMVERSKEAATSPYVARKESTGFIFNRLWAAVKREVMTILAEGVSVPE
EIDSMWNELFIKGKSLPCRTMDNVGLDTVAFIESHYVQERGLSPEKTVDFLKANYLDQGKLGTKCSKGGLYPASE
STSTPKTPDLLVLDIGLSAIKPGVTSGEIVRFAADGTLKNVVLKDQSLPDGLIIDPISGRMFWTCMGAPGKFDGG
VYSANVDGTDIKTLIAPGTINTPKQIVLHSEAKTVYFCDREGCRVYRCAYDGSNLEVLIDNTGGEANPQHRISDW
CVGIAVVPNYGKFYWTQKGPSKAGKGRIFCANITTPEGESPDARSDVQVVLADLPEPIDLEVHEATHTLYWTDRG
ELPIGNSLNKAQLSEQGLLLPASSALGYDVITRNLNEAIGLILDPANSQIYLTDLGGSIYRTDMDGNNKEKIYSN
DDRAFTGIALV*
Coding >Pro_DTO377G3_2|g283.t1
ATGAACACTTTGCGTCGCAGCATGGCATCACACTGGGTACCTCCGAGCAACTACCGCAACCGCCCAGTCACCATT
CTGGGTGCCGGCGTACTCGGCCGCCGAATTGGTTGTATCTGGGCTTCAGCCGGCTACGATGTTCGAATTCGAGAC
CCTAGCTCGCAGCAGCGAGCAGACGGAATTGCATACATTCAGGAAAATGTCCAATCCTACGCCGCCAAAACAAAG
CAAATCCCCGGATCCTTTGAAGCCTTCGAAGACATGAAGAAAGCCGTTGAAAACGCCTGGCTTGTGATTGAAGCT
GTTCCCGAGAAGCTCGAACTTAAGATCTCCACTTTCGCTGAATTGGAAGCCCTCGCCCCGGAGGACTGCATCCTG
GCTTCCAACTCATCATCATACAAATCTTCTGAGATAATCAGTCAGATCTCGGATGCCACCAAGAAGCGTGTTCTG
AACATGCATTATTATATGCCGCCGTCGTGTATGATCGTGGAGCTCATGACCGATGGACACACTGCCCCAGAGATC
TTCCCTTTCATGGTCGAGCGCTCCAAGGAAGCCGCCACAAGTCCATATGTTGCGCGAAAGGAGTCCACTGGGTTC
ATCTTCAATCGGCTGTGGGCTGCTGTGAAGCGGGAGGTCATGACTATCTTGGCTGAGGGTGTTTCGGTTCCTGAG
GAAATTGATTCGATGTGGAATGAACTGTTCATCAAGGGAAAGAGTCTTCCCTGCCGGACAATGGACAATGTTGGC
CTAGACACCGTCGCCTTCATTGAGAGTCATTATGTGCAGGAACGTGGGCTCTCCCCCGAGAAGACGGTCGACTTT
TTGAAGGCCAATTACCTGGACCAGGGCAAACTGGGAACAAAGTGCTCGAAGGGTGGCCTCTATCCTGCTAGCGAG
TCGACTTCTACTCCCAAGACTCCCGACCTTTTAGTGTTGGACATTGGACTGTCAGCCATCAAACCCGGCGTGACA
TCAGGAGAGATCGTTCGCTTTGCCGCAGACGGCACGCTAAAGAACGTGGTTCTCAAGGACCAATCCTTGCCTGAT
GGGCTCATCATAGACCCGATCTCTGGCCGCATGTTCTGGACTTGCATGGGCGCTCCAGGGAAGTTCGACGGAGGC
GTTTACTCCGCCAACGTGGATGGAACCGACATCAAAACACTCATTGCCCCAGGAACTATCAATACACCGAAACAA
ATAGTCCTCCATTCCGAGGCGAAAACTGTCTATTTCTGTGACCGTGAAGGCTGCCGCGTCTACCGTTGTGCCTAC
GACGGCTCCAATCTCGAGGTTTTGATTGATAACACCGGCGGTGAAGCGAATCCACAGCACCGCATCTCCGACTGG
TGCGTCGGAATTGCTGTGGTGCCAAATTATGGTAAATTCTATTGGACCCAGAAAGGACCCTCGAAGGCTGGCAAA
GGCCGGATCTTCTGCGCCAATATCACAACCCCTGAGGGCGAGTCACCAGATGCTCGAAGTGATGTCCAGGTTGTT
CTGGCTGATCTCCCCGAGCCGATTGATCTCGAGGTGCACGAAGCCACTCACACACTTTACTGGACCGATCGTGGT
GAACTCCCGATCGGCAACTCACTGAACAAAGCTCAGTTGAGTGAACAAGGTCTCCTTCTGCCAGCTAGCTCCGCT
CTGGGATATGATGTCATCACCAGAAATCTGAACGAGGCAATCGGTTTGATCTTAGATCCCGCCAATTCTCAGATC
TATCTTACTGACCTGGGCGGATCTATCTACCGGACCGATATGGATGGCAACAACAAGGAGAAGATTTACTCCAAT
GATGACCGGGCCTTTACTGGAATTGCCCTTGTGTAA
Transcript >Pro_DTO377G3_2|g283.t1
ATGAACACTTTGCGTCGCAGCATGGCATCACACTGGGTACCTCCGAGCAACTACCGCAACCGCCCAGTCACCATT
CTGGGTGCCGGCGTACTCGGCCGCCGAATTGGTTGTATCTGGGCTTCAGCCGGCTACGATGTTCGAATTCGAGAC
CCTAGCTCGCAGCAGCGAGCAGACGGAATTGCATACATTCAGGAAAATGTCCAATCCTACGCCGCCAAAACAAAG
CAAATCCCCGGATCCTTTGAAGCCTTCGAAGACATGAAGAAAGCCGTTGAAAACGCCTGGCTTGTGATTGAAGCT
GTTCCCGAGAAGCTCGAACTTAAGATCTCCACTTTCGCTGAATTGGAAGCCCTCGCCCCGGAGGACTGCATCCTG
GCTTCCAACTCATCATCATACAAATCTTCTGAGATAATCAGTCAGATCTCGGATGCCACCAAGAAGCGTGTTCTG
AACATGCATTATTATATGCCGCCGTCGTGTATGATCGTGGAGCTCATGACCGATGGACACACTGCCCCAGAGATC
TTCCCTTTCATGGTCGAGCGCTCCAAGGAAGCCGCCACAAGTCCATATGTTGCGCGAAAGGAGTCCACTGGGTTC
ATCTTCAATCGGCTGTGGGCTGCTGTGAAGCGGGAGGTCATGACTATCTTGGCTGAGGGTGTTTCGGTTCCTGAG
GAAATTGATTCGATGTGGAATGAACTGTTCATCAAGGGAAAGAGTCTTCCCTGCCGGACAATGGACAATGTTGGC
CTAGACACCGTCGCCTTCATTGAGAGTCATTATGTGCAGGAACGTGGGCTCTCCCCCGAGAAGACGGTCGACTTT
TTGAAGGCCAATTACCTGGACCAGGGCAAACTGGGAACAAAGTGCTCGAAGGGTGGCCTCTATCCTGCTAGCGAG
TCGACTTCTACTCCCAAGACTCCCGACCTTTTAGTGTTGGACATTGGACTGTCAGCCATCAAACCCGGCGTGACA
TCAGGAGAGATCGTTCGCTTTGCCGCAGACGGCACGCTAAAGAACGTGGTTCTCAAGGACCAATCCTTGCCTGAT
GGGCTCATCATAGACCCGATCTCTGGCCGCATGTTCTGGACTTGCATGGGCGCTCCAGGGAAGTTCGACGGAGGC
GTTTACTCCGCCAACGTGGATGGAACCGACATCAAAACACTCATTGCCCCAGGAACTATCAATACACCGAAACAA
ATAGTCCTCCATTCCGAGGCGAAAACTGTCTATTTCTGTGACCGTGAAGGCTGCCGCGTCTACCGTTGTGCCTAC
GACGGCTCCAATCTCGAGGTTTTGATTGATAACACCGGCGGTGAAGCGAATCCACAGCACCGCATCTCCGACTGG
TGCGTCGGAATTGCTGTGGTGCCAAATTATGGTAAATTCTATTGGACCCAGAAAGGACCCTCGAAGGCTGGCAAA
GGCCGGATCTTCTGCGCCAATATCACAACCCCTGAGGGCGAGTCACCAGATGCTCGAAGTGATGTCCAGGTTGTT
CTGGCTGATCTCCCCGAGCCGATTGATCTCGAGGTGCACGAAGCCACTCACACACTTTACTGGACCGATCGTGGT
GAACTCCCGATCGGCAACTCACTGAACAAAGCTCAGTTGAGTGAACAAGGTCTCCTTCTGCCAGCTAGCTCCGCT
CTGGGATATGATGTCATCACCAGAAATCTGAACGAGGCAATCGGTTTGATCTTAGATCCCGCCAATTCTCAGATC
TATCTTACTGACCTGGGCGGATCTATCTACCGGACCGATATGGATGGCAACAACAAGGAGAAGATTTACTCCAAT
GATGACCGGGCCTTTACTGGAATTGCCCTTGTGTAA
Gene >Pro_DTO377G3_2|g283.t1
ATGAACACTTTGCGTCGCAGCATGGCATCACACTGGGTACCTCCGAGCAACTACCGCAACCGCCCAGTCACCATT
CTGGGTGCCGGCGTACTCGGCCGCCGAATTGGTCTGTATCCCATCCCACGTGTTATTCAATGGATAGAAGTGTTG
ACAAACTTCGGCTATTAGGTTGTATCTGGGCTTCAGCCGGCTACGATGTTCGAATTCGAGACCCTAGCTCGCAGC
AGCGAGCAGACGGAATTGCATACATTCAGGAAAATGTCCAATCCTACGCCGCCAAAACAAAGCAAATCCCCGGAT
CCTTTGAAGCCTTCGAAGACATGAAGAAAGCCGTTGAAAACGCCTGGCTTGTGATTGAAGCTGTTCCCGAGAAGC
TCGAACTTAAGATCTCCACTTTCGCTGAATTGGAAGCCCTCGCCCCGGAGGACTGCATCCTGGCTTCCAACTCAT
CATCATACAAATCTTCTGAGATAATCAGTCAGATCTCGGATGCCACCAAGAAGCGTGTTCTGAACATGCATTATT
ATATGCCGCCGTCGTGTATGATCGTGGAGCTCATGACCGATGGACACACTGCCCCAGAGATCTTCCCTTTCATGG
TCGAGCGCTCCAAGGAAGCCGCCACAAGTCCATATGTTGCGCGAAAGGAGTCCACTGGGTTCATCTTCAATCGGC
TGTGGGCTGCTGTGAAGCGGGAGGTCATGACTATCTTGGCTGAGGGTGTTTCGGTTCCTGAGGAAATTGATTCGA
TGTGGAATGAACTGTTCATCAAGGGAAAGAGTCTTCCCTGCCGGACAATGGACAGTAAGTCCTTCACTCGTCTCC
CTAGTTTTGTGGGAAGTTGTTCGCTAACATAAATTGCCTAGATGTTGGCCTAGACACCGTCGCCTTCATTGAGAG
TCATTATGTGCAGGAACGTGGGCTCTCCCCCGAGAAGACGGTCGACTTTTTGAAGGCCAATTACCTGGACCAGGG
CAAACTGGGAACAAAGTGCTCGAAGGGTGGCCTCTATCCTGCTAGCGAGTCGACTTCTACTCCCAAGACTCCCGA
CCTTTTAGTGTTGGACATTGGACTGTCAGCCATCAAACCCGGCGTGACATCAGGAGAGATCGTTCGCTTTGCCGC
AGACGGCACGCTAAAGAACGTGGTTCTCAAGGACCAATCCTTGCCTGATGGGCTCATCATAGACCCGATCTCTGG
CCGCATGTTCTGGACTTGCATGGGCGCTCCAGGGAAGTTCGACGGAGGCGTTTACTCCGCCAACGTGGATGGAAC
CGACATCAAAACACTCATTGCCCCAGGAACTATCAATACACCGAAACAAATAGTCCTCCATTCCGAGGCGAAAAC
TGTCTATTTCTGTGACCGTGAAGGCTGCCGCGTCTACCGTTGTGCCTACGACGGCTCCAATCTCGAGGTTTTGAT
TGATAACACCGGCGGTGAAGCGAATCCACAGCACCGCATCTCCGACTGGTGCGTCGGAATTGCTGTGGTGCCAAA
TTATGGTAAATTCTATTGGACCCAGAAAGGACCCTCGAAGGCTGGCAAAGGCCGGATCTTCTGCGCCAATATCAC
AACCCCTGAGGGCGAGTCACCAGATGCTCGAAGTGATGTCCAGGTTGTTCTGGCTGATCTCCCCGAGCCGATTGA
TCTCGAGGTGCACGAAGCCACTCACACACTTTACTGGACCGATCGTGGTGAACTCCCGATCGGCAACTCACTGAA
CAAAGCTCAGTTGAGTGAACAAGGTCTCCTTCTGCCAGCTAGCTCCGCTCTGGGATATGATGTCATCACCAGAAA
TCTGAACGAGGCAATCGGTTTGATCTTAGATCCCGCCAATTCTCAGATCTATCTTACTGACCTGGGCGGATCTAT
CTACCGGACCGATATGGATGGCAACAACAAGGAGAAGATTTACTCCAATGATGACCGGGCCTTTACTGGAATTGC
CCTTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail