Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2829.t1
Gene name
Locationscaffold_03:1061130..1063404
Strand+
Gene length (bp)2274
Transcript length (bp)2274
Coding sequence length (bp)2274
Protein length (aa) 758

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14611 SLS Mitochondrial inner-membrane-bound regulator 5.2E-34 205 402

GO

GO Term Description Terminal node
GO:0005743 mitochondrial inner membrane Yes
GO:0044429 mitochondrial part No
GO:0019866 organelle inner membrane No
GO:0031090 organelle membrane No
GO:0044424 intracellular part No
GO:0005575 cellular_component No
GO:0044422 organelle part No
GO:0016020 membrane No
GO:0031966 mitochondrial membrane No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0044444 cytoplasmic part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2829.t1
MLRRPTGNKLGLLSFQSLSYRRPLLSYPHAVLPRYQSNWSRDDERDAFDGPKSERNREQKDNGKRETGTFTLDVD
TLGKPGQIVVVPSRRRRMLNRNRNKKPGNEYAGTISTMLDELNEENSSPSDKSVHERIDEIRGSYQVGQILPAAD
LKALWSKLASSFTYKQLSEFISEYNRNSVIEEKGWTWGSSNSKSLLGKTKGFRGKSRAAETIVRNCWQLVADGER
GQLEFRIPAQFISLLLHAEHFSFHELASLHGCGIDVTQSAGLVSLTGKRDDCESVHEIIIDATGRIREDDVGINP
YIHGDGISQVFTPDFLEWVNSTHGVFVEHRAHRPPQKILYLNENKLGADNARRTLNLALSNTTSPSTPFSTYLPA
SELASAYSYKPESHASWFEQQKSWFRWAMSSSQNAEAESLETPFFDKHQTRLSDELLKLLRVTPPKNGFVAGLHE
SVTAVVGKCLFMQKPSFDDTAISPAQLGRLSLPRAFTNDVPLVSRFINSLTPIRPKNEAQLYRLRLSPTSNTASP
PELEIEIAVNSNLNGVDVHSVKAILATNSVDYLLPENGLDLRFTRTISQDLLYKSSPNSENPQSSSEHLFPETSF
SLPIQVMLQSIKTSLQGSIVNSGASQGPVHIPIFCNIILPCDLVHQPASQKTKSKKSDESMAESSIAVEYMFPPL
SDIRGAVIQKYNFDGRPLDYRYYESGSFLAARTNEVSLGMQIPQIDLAAGNNHSEQLDHEFHSFYNAACDMAFKI
HGKRYVD*
Coding >Pro_DTO377G3_2|g2829.t1
ATGCTTCGACGCCCCACAGGGAACAAGCTGGGGCTTCTGAGCTTCCAGTCGCTTTCATATCGGAGACCATTATTG
TCATACCCACACGCTGTTCTTCCCCGATACCAGAGTAACTGGAGTCGCGATGATGAACGCGACGCTTTCGATGGC
CCCAAATCCGAACGAAACCGCGAACAGAAAGATAATGGAAAACGTGAAACAGGCACGTTTACATTGGATGTGGAT
ACGCTTGGAAAGCCAGGGCAAATAGTTGTTGTGCCTTCCCGTCGCCGCCGAATGTTGAATCGCAATCGCAACAAA
AAGCCCGGGAATGAATATGCCGGCACAATCAGCACCATGTTGGATGAACTTAACGAGGAAAACTCATCGCCCAGC
GATAAGTCAGTCCATGAAAGAATTGATGAGATTCGTGGATCATATCAAGTAGGACAGATCTTGCCTGCTGCCGAT
CTCAAGGCATTGTGGTCAAAATTAGCTTCCTCTTTCACATACAAGCAATTGTCGGAGTTTATTTCAGAGTACAAC
CGCAATTCTGTGATAGAAGAGAAAGGTTGGACATGGGGGTCAAGTAACTCCAAATCGTTATTGGGAAAGACCAAG
GGCTTCAGGGGAAAATCCCGGGCTGCAGAGACGATCGTTCGGAATTGTTGGCAGCTGGTGGCTGATGGCGAGCGT
GGCCAGCTGGAATTCCGCATACCAGCTCAATTCATATCCTTGCTTCTCCATGCTGAGCATTTCTCTTTCCATGAG
CTAGCTAGTCTCCATGGCTGTGGTATTGATGTCACACAATCTGCGGGCCTTGTATCACTTACTGGCAAGCGAGAT
GATTGTGAGTCTGTGCACGAGATTATCATTGATGCCACTGGCAGAATCCGCGAGGATGATGTTGGAATCAACCCA
TATATTCATGGAGATGGAATAAGTCAAGTTTTTACACCAGACTTTTTGGAATGGGTCAACAGCACACACGGTGTA
TTTGTGGAACACCGAGCACACAGACCACCACAAAAGATTCTCTATCTTAACGAGAATAAGTTGGGAGCGGATAAT
GCGCGGAGGACCTTGAACTTGGCCTTATCCAACACTACATCTCCATCGACGCCATTTTCAACATATTTACCTGCT
TCAGAACTTGCCAGTGCCTATAGCTACAAACCAGAAAGTCATGCTTCGTGGTTCGAGCAGCAAAAGTCTTGGTTC
CGCTGGGCAATGTCTTCCAGTCAAAACGCGGAGGCGGAATCCCTCGAAACCCCTTTCTTCGACAAGCATCAAACA
CGACTCTCAGATGAACTATTGAAGCTTCTCCGGGTTACTCCTCCGAAGAACGGTTTTGTCGCCGGTTTGCATGAA
TCCGTGACAGCCGTGGTTGGGAAATGCCTTTTTATGCAAAAGCCCTCTTTCGATGATACAGCCATCAGTCCGGCA
CAGCTAGGGAGACTCTCCCTTCCACGGGCTTTCACAAACGACGTACCTCTGGTGTCGCGTTTCATCAACTCACTC
ACGCCTATTCGCCCGAAGAACGAGGCACAGCTATATCGACTTCGATTGTCTCCAACCTCAAACACAGCATCCCCA
CCGGAACTCGAAATTGAGATAGCCGTGAATTCAAACTTGAATGGCGTGGACGTCCACAGCGTAAAGGCTATCCTC
GCCACAAACAGCGTTGACTACTTGCTTCCGGAAAATGGTCTGGACCTGCGTTTCACACGAACTATCTCCCAAGAC
CTCTTGTATAAGTCATCTCCCAACTCAGAAAACCCGCAAAGCTCCTCTGAGCACCTCTTCCCCGAGACTTCCTTT
TCGCTCCCGATCCAAGTAATGCTGCAAAGCATTAAAACCTCACTCCAGGGCTCAATTGTCAACAGTGGGGCTTCG
CAAGGTCCTGTTCACATTCCTATATTTTGCAACATCATCCTTCCCTGTGATCTTGTTCACCAGCCTGCCTCGCAA
AAAACCAAATCCAAGAAGTCAGACGAATCAATGGCAGAGAGCAGCATCGCTGTGGAATACATGTTCCCTCCACTC
AGCGACATTCGAGGCGCCGTTATCCAAAAGTACAACTTTGATGGACGGCCGCTTGACTACCGGTACTACGAAAGC
GGTTCGTTCCTTGCTGCTCGGACAAACGAGGTCTCTCTGGGTATGCAGATTCCTCAAATTGACTTGGCCGCAGGG
AATAACCACTCCGAGCAGCTTGATCATGAGTTCCACTCGTTCTACAACGCGGCATGTGACATGGCATTCAAAATC
CACGGCAAAAGATACGTGGATTAA
Transcript >Pro_DTO377G3_2|g2829.t1
ATGCTTCGACGCCCCACAGGGAACAAGCTGGGGCTTCTGAGCTTCCAGTCGCTTTCATATCGGAGACCATTATTG
TCATACCCACACGCTGTTCTTCCCCGATACCAGAGTAACTGGAGTCGCGATGATGAACGCGACGCTTTCGATGGC
CCCAAATCCGAACGAAACCGCGAACAGAAAGATAATGGAAAACGTGAAACAGGCACGTTTACATTGGATGTGGAT
ACGCTTGGAAAGCCAGGGCAAATAGTTGTTGTGCCTTCCCGTCGCCGCCGAATGTTGAATCGCAATCGCAACAAA
AAGCCCGGGAATGAATATGCCGGCACAATCAGCACCATGTTGGATGAACTTAACGAGGAAAACTCATCGCCCAGC
GATAAGTCAGTCCATGAAAGAATTGATGAGATTCGTGGATCATATCAAGTAGGACAGATCTTGCCTGCTGCCGAT
CTCAAGGCATTGTGGTCAAAATTAGCTTCCTCTTTCACATACAAGCAATTGTCGGAGTTTATTTCAGAGTACAAC
CGCAATTCTGTGATAGAAGAGAAAGGTTGGACATGGGGGTCAAGTAACTCCAAATCGTTATTGGGAAAGACCAAG
GGCTTCAGGGGAAAATCCCGGGCTGCAGAGACGATCGTTCGGAATTGTTGGCAGCTGGTGGCTGATGGCGAGCGT
GGCCAGCTGGAATTCCGCATACCAGCTCAATTCATATCCTTGCTTCTCCATGCTGAGCATTTCTCTTTCCATGAG
CTAGCTAGTCTCCATGGCTGTGGTATTGATGTCACACAATCTGCGGGCCTTGTATCACTTACTGGCAAGCGAGAT
GATTGTGAGTCTGTGCACGAGATTATCATTGATGCCACTGGCAGAATCCGCGAGGATGATGTTGGAATCAACCCA
TATATTCATGGAGATGGAATAAGTCAAGTTTTTACACCAGACTTTTTGGAATGGGTCAACAGCACACACGGTGTA
TTTGTGGAACACCGAGCACACAGACCACCACAAAAGATTCTCTATCTTAACGAGAATAAGTTGGGAGCGGATAAT
GCGCGGAGGACCTTGAACTTGGCCTTATCCAACACTACATCTCCATCGACGCCATTTTCAACATATTTACCTGCT
TCAGAACTTGCCAGTGCCTATAGCTACAAACCAGAAAGTCATGCTTCGTGGTTCGAGCAGCAAAAGTCTTGGTTC
CGCTGGGCAATGTCTTCCAGTCAAAACGCGGAGGCGGAATCCCTCGAAACCCCTTTCTTCGACAAGCATCAAACA
CGACTCTCAGATGAACTATTGAAGCTTCTCCGGGTTACTCCTCCGAAGAACGGTTTTGTCGCCGGTTTGCATGAA
TCCGTGACAGCCGTGGTTGGGAAATGCCTTTTTATGCAAAAGCCCTCTTTCGATGATACAGCCATCAGTCCGGCA
CAGCTAGGGAGACTCTCCCTTCCACGGGCTTTCACAAACGACGTACCTCTGGTGTCGCGTTTCATCAACTCACTC
ACGCCTATTCGCCCGAAGAACGAGGCACAGCTATATCGACTTCGATTGTCTCCAACCTCAAACACAGCATCCCCA
CCGGAACTCGAAATTGAGATAGCCGTGAATTCAAACTTGAATGGCGTGGACGTCCACAGCGTAAAGGCTATCCTC
GCCACAAACAGCGTTGACTACTTGCTTCCGGAAAATGGTCTGGACCTGCGTTTCACACGAACTATCTCCCAAGAC
CTCTTGTATAAGTCATCTCCCAACTCAGAAAACCCGCAAAGCTCCTCTGAGCACCTCTTCCCCGAGACTTCCTTT
TCGCTCCCGATCCAAGTAATGCTGCAAAGCATTAAAACCTCACTCCAGGGCTCAATTGTCAACAGTGGGGCTTCG
CAAGGTCCTGTTCACATTCCTATATTTTGCAACATCATCCTTCCCTGTGATCTTGTTCACCAGCCTGCCTCGCAA
AAAACCAAATCCAAGAAGTCAGACGAATCAATGGCAGAGAGCAGCATCGCTGTGGAATACATGTTCCCTCCACTC
AGCGACATTCGAGGCGCCGTTATCCAAAAGTACAACTTTGATGGACGGCCGCTTGACTACCGGTACTACGAAAGC
GGTTCGTTCCTTGCTGCTCGGACAAACGAGGTCTCTCTGGGTATGCAGATTCCTCAAATTGACTTGGCCGCAGGG
AATAACCACTCCGAGCAGCTTGATCATGAGTTCCACTCGTTCTACAACGCGGCATGTGACATGGCATTCAAAATC
CACGGCAAAAGATACGTGGATTAA
Gene >Pro_DTO377G3_2|g2829.t1
ATGCTTCGACGCCCCACAGGGAACAAGCTGGGGCTTCTGAGCTTCCAGTCGCTTTCATATCGGAGACCATTATTG
TCATACCCACACGCTGTTCTTCCCCGATACCAGAGTAACTGGAGTCGCGATGATGAACGCGACGCTTTCGATGGC
CCCAAATCCGAACGAAACCGCGAACAGAAAGATAATGGAAAACGTGAAACAGGCACGTTTACATTGGATGTGGAT
ACGCTTGGAAAGCCAGGGCAAATAGTTGTTGTGCCTTCCCGTCGCCGCCGAATGTTGAATCGCAATCGCAACAAA
AAGCCCGGGAATGAATATGCCGGCACAATCAGCACCATGTTGGATGAACTTAACGAGGAAAACTCATCGCCCAGC
GATAAGTCAGTCCATGAAAGAATTGATGAGATTCGTGGATCATATCAAGTAGGACAGATCTTGCCTGCTGCCGAT
CTCAAGGCATTGTGGTCAAAATTAGCTTCCTCTTTCACATACAAGCAATTGTCGGAGTTTATTTCAGAGTACAAC
CGCAATTCTGTGATAGAAGAGAAAGGTTGGACATGGGGGTCAAGTAACTCCAAATCGTTATTGGGAAAGACCAAG
GGCTTCAGGGGAAAATCCCGGGCTGCAGAGACGATCGTTCGGAATTGTTGGCAGCTGGTGGCTGATGGCGAGCGT
GGCCAGCTGGAATTCCGCATACCAGCTCAATTCATATCCTTGCTTCTCCATGCTGAGCATTTCTCTTTCCATGAG
CTAGCTAGTCTCCATGGCTGTGGTATTGATGTCACACAATCTGCGGGCCTTGTATCACTTACTGGCAAGCGAGAT
GATTGTGAGTCTGTGCACGAGATTATCATTGATGCCACTGGCAGAATCCGCGAGGATGATGTTGGAATCAACCCA
TATATTCATGGAGATGGAATAAGTCAAGTTTTTACACCAGACTTTTTGGAATGGGTCAACAGCACACACGGTGTA
TTTGTGGAACACCGAGCACACAGACCACCACAAAAGATTCTCTATCTTAACGAGAATAAGTTGGGAGCGGATAAT
GCGCGGAGGACCTTGAACTTGGCCTTATCCAACACTACATCTCCATCGACGCCATTTTCAACATATTTACCTGCT
TCAGAACTTGCCAGTGCCTATAGCTACAAACCAGAAAGTCATGCTTCGTGGTTCGAGCAGCAAAAGTCTTGGTTC
CGCTGGGCAATGTCTTCCAGTCAAAACGCGGAGGCGGAATCCCTCGAAACCCCTTTCTTCGACAAGCATCAAACA
CGACTCTCAGATGAACTATTGAAGCTTCTCCGGGTTACTCCTCCGAAGAACGGTTTTGTCGCCGGTTTGCATGAA
TCCGTGACAGCCGTGGTTGGGAAATGCCTTTTTATGCAAAAGCCCTCTTTCGATGATACAGCCATCAGTCCGGCA
CAGCTAGGGAGACTCTCCCTTCCACGGGCTTTCACAAACGACGTACCTCTGGTGTCGCGTTTCATCAACTCACTC
ACGCCTATTCGCCCGAAGAACGAGGCACAGCTATATCGACTTCGATTGTCTCCAACCTCAAACACAGCATCCCCA
CCGGAACTCGAAATTGAGATAGCCGTGAATTCAAACTTGAATGGCGTGGACGTCCACAGCGTAAAGGCTATCCTC
GCCACAAACAGCGTTGACTACTTGCTTCCGGAAAATGGTCTGGACCTGCGTTTCACACGAACTATCTCCCAAGAC
CTCTTGTATAAGTCATCTCCCAACTCAGAAAACCCGCAAAGCTCCTCTGAGCACCTCTTCCCCGAGACTTCCTTT
TCGCTCCCGATCCAAGTAATGCTGCAAAGCATTAAAACCTCACTCCAGGGCTCAATTGTCAACAGTGGGGCTTCG
CAAGGTCCTGTTCACATTCCTATATTTTGCAACATCATCCTTCCCTGTGATCTTGTTCACCAGCCTGCCTCGCAA
AAAACCAAATCCAAGAAGTCAGACGAATCAATGGCAGAGAGCAGCATCGCTGTGGAATACATGTTCCCTCCACTC
AGCGACATTCGAGGCGCCGTTATCCAAAAGTACAACTTTGATGGACGGCCGCTTGACTACCGGTACTACGAAAGC
GGTTCGTTCCTTGCTGCTCGGACAAACGAGGTCTCTCTGGGTATGCAGATTCCTCAAATTGACTTGGCCGCAGGG
AATAACCACTCCGAGCAGCTTGATCATGAGTTCCACTCGTTCTACAACGCGGCATGTGACATGGCATTCAAAATC
CACGGCAAAAGATACGTGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail