Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2818.t1
Gene name
Locationscaffold_03:1035206..1036055
Strand+
Gene length (bp)849
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 102 124 22
3 158 180 22
4 200 222 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 171.57 104.29 238.86
5d_25C Five days - 25 degrees Celsius 241.37 147.07 335.68
7d_25C Seven days - 25 degrees Celsius 272.36 165.62 379.10
10d_25C Ten days - 25 degrees Celsius 379.79 230.55 529.02
7d_15C Seven days - 15 degrees Celsius 283.13 170.46 395.79
7d_30C Seven days - 30 degrees Celsius 180.97 109.66 252.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.117342 no
3d_25C 7d_25C 0.020140 yes
3d_25C 7d_15C 0.017204 yes
3d_25C 7d_30C 0.867718 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.671102 no
5d_25C 7d_15C 0.547864 no
5d_25C 7d_30C 0.203510 no
5d_25C 10d_25C 0.024417 yes
7d_25C 7d_15C 0.906722 no
7d_25C 7d_30C 0.046354 yes
7d_25C 10d_25C 0.125142 no
7d_15C 7d_30C 0.029770 yes
7d_15C 10d_25C 0.194540 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2818.t1
MVSTRHHPREFPSPEVGKELAKLPPATTSANSRKWTHTPAAALTIWLIVSVPLVIWDTGYVLLRPHSMPGGSLHS
PIWTPYALYGKVDYIYGWPAFNAHNGFTAAQTMLNVLETIGYIYYLWIVYHYGSTVGRGGRSQNISKEFTWLLKG
DKVVAGRIGATALLVAYTASVMTLSKTILYWLNEIFSGFENIGHNDPLTLFLYWILPNGLWLVFPSYNIYVLGAE
ILNSLELATPRHKVGRPKST*
Coding >Pro_DTO377G3_2|g2818.t1
ATGGTCTCCACGCGACACCATCCCCGCGAATTCCCCTCCCCCGAGGTCGGGAAAGAGCTAGCCAAGTTACCCCCA
GCTACCACCAGCGCCAATTCGCGCAAATGGACCCATACGCCCGCTGCTGCGCTGACAATCTGGCTCATTGTTTCG
GTTCCCTTGGTAATATGGGACACAGGCTATGTCTTGTTGCGACCACATAGCATGCCCGGTGGAAGTCTACACTCT
CCCATCTGGACGCCTTACGCGCTGTACGGAAAAGTGGACTATATCTATGGCTGGCCAGCCTTCAATGCGCATAAT
GGCTTCACGGCTGCACAGACTATGCTCAACGTCCTCGAGACTATCGGTTACATCTATTACCTCTGGATTGTCTAC
CACTATGGATCGACGGTTGGGAGAGGTGGCAGATCGCAGAATATCTCCAAGGAATTCACCTGGTTGCTGAAGGGG
GACAAGGTCGTCGCTGGGCGCATTGGTGCGACCGCACTTCTGGTCGCCTACACCGCGTCTGTCATGACCCTGAGC
AAGACCATCCTTTACTGGCTCAACGAGATCTTCTCTGGCTTCGAGAACATCGGTCACAACGACCCGCTTACTCTG
TTCCTCTACTGGATCCTCCCTAATGGGCTGTGGCTCGTGTTTCCCAGCTACAATATCTATGTTCTCGGGGCCGAG
ATTCTGAACTCGCTTGAGCTCGCAACACCACGCCATAAGGTTGGACGCCCGAAATCCACCTAG
Transcript >Pro_DTO377G3_2|g2818.t1
ATGGTCTCCACGCGACACCATCCCCGCGAATTCCCCTCCCCCGAGGTCGGGAAAGAGCTAGCCAAGTTACCCCCA
GCTACCACCAGCGCCAATTCGCGCAAATGGACCCATACGCCCGCTGCTGCGCTGACAATCTGGCTCATTGTTTCG
GTTCCCTTGGTAATATGGGACACAGGCTATGTCTTGTTGCGACCACATAGCATGCCCGGTGGAAGTCTACACTCT
CCCATCTGGACGCCTTACGCGCTGTACGGAAAAGTGGACTATATCTATGGCTGGCCAGCCTTCAATGCGCATAAT
GGCTTCACGGCTGCACAGACTATGCTCAACGTCCTCGAGACTATCGGTTACATCTATTACCTCTGGATTGTCTAC
CACTATGGATCGACGGTTGGGAGAGGTGGCAGATCGCAGAATATCTCCAAGGAATTCACCTGGTTGCTGAAGGGG
GACAAGGTCGTCGCTGGGCGCATTGGTGCGACCGCACTTCTGGTCGCCTACACCGCGTCTGTCATGACCCTGAGC
AAGACCATCCTTTACTGGCTCAACGAGATCTTCTCTGGCTTCGAGAACATCGGTCACAACGACCCGCTTACTCTG
TTCCTCTACTGGATCCTCCCTAATGGGCTGTGGCTCGTGTTTCCCAGCTACAATATCTATGTTCTCGGGGCCGAG
ATTCTGAACTCGCTTGAGCTCGCAACACCACGCCATAAGGTTGGACGCCCGAAATCCACCTAG
Gene >Pro_DTO377G3_2|g2818.t1
ATGGTCTCCACGCGACACCATCCCCGCGAATTCCCCTCCCCCGAGGTCGGGAAAGAGCTAGCCAAGTTACCCCCA
GCTACCACCAGCGCCAATTCGCGCAAATGGACCCATACGCCCGCTGCTGCGCTGACAATCTGGCTCATTGTTTCG
GTTCCCTTGGTAATATGGGACACAGGCTATGTCTTGTTGCGACCACATAGCATGCCCGGTGGAAGTCTACACTCT
CCCATCTGGACGCCTTACGCGCTGTACGGAAAAGTGGACTATATCTATGGCTGGCCAGCCTTCAATGCGCATAAT
GGCTTCACGGCTGCACAGACTATGCTCAACGTCCTCGAGACTATCGGTTACATCTATTACCTCTGGATTGTCTAC
CACTATGGATCGACGGTTGGGAGAGGTGGCAGATCGCAGAATATCTCCAAGGAATTCACCTGGTTGCTGAAGGGG
GACAAGGTCGTCGCTGGGCGCATTGGTGCGACCGCACTTCTGGTCGCCTACACCGCGTCTGTCATGACCCTGAGC
AAGACCATCCTTTACTGTAAGCTATATCTATTTCCTGGGCTTTGTGTGTCGGATTATAACACAAAACAAAATAGG
GCTCAACGAGATCTTCTCTGGCTTCGAGAACATCGGTCACAACGACCCGCTTACTCTGTTCCTCTACTGGATCCT
CCCTAAGTGAGCTCCGTCTAGTGCATGTTTACATGAAATATAACACTAATATCATTCAGTGGGCTGTGGCTCGTG
TTTCCCAGCTACAATATCTATGTTCTCGGGGCCGAGATTCTGAACTCGCTTGAGCTCGCAACACCACGCCATAAG
GTTGGACGCCCGAAATCCACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail