Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2816.t1
Gene name
Locationscaffold_03:1027857..1030571
Strand-
Gene length (bp)2714
Transcript length (bp)2598
Coding sequence length (bp)2598
Protein length (aa) 866

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 1.2E-53 398 656
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 5.5E-39 82 338
PF14310 Fn3-like Fibronectin type III-like domain 1.2E-17 784 852

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2816.t1
MKLAWFEVAALSASVTSASSLAYSPPYYPSPWMTGEGEWSEAYTRAVEFVSNLTLAEKVNLTTGTGWEQERCVGE
TGSIPRLGMWGMCMQDSPLGVRSSDYTSGFPSGVNVAAAWDKRLAYQRGVAMGEEHRDKGVDVQLGPVAGPLGKN
PDGGRNWEGFSPDPVLTGVMMAETIKGMQDAGIIACAKHFIGNEQEHFRQPGEAQGFGYNISQSMSSNIDDKTMH
ELYLWPFVDSIRAGVGSVMCSYNQINNSYSCANSYSLNKLLKGELGFQGFVMSDWGAHHSGVESALAGLDMSMPG
DVILGSPYSYWATNLTISVLNGTVPEWRLDDMAVRIMSAYYKVGRDRFRTPPNFSSWTRDEYNFEHSMVSEGWGK
VNEHVNVQRDHAQIIRKIGSDSIVLLKNKAGALPLTHDERFIGIIGEDAGSNAYGANGCSDRGCDNGTLAMGWGS
GTANFPYLITPEQAIQNEVLEYSNGQTNVFAVTDNWALTEMAALASQADVALVFVNADAGEGYISVDGNEGDRKN
LTLWKNGEEIIKAASQHCNNTIVVIHSTSAVLISDWYDNVNITAIVWAGLPGQESGRSLVDVLYGRVNPGGKTPF
TWGKTRKDYGPPILTVPNNGVDAPQVNFEDGVFIDYRRFDKDNTEPIYEFGYGLSYTNFAFSDLKVTPLASSEQR
EYKATTGKSQKAPVLGEAGKVLDNLFPEGITRVRQYLYPWLNSTDLRASSGDPDYGMDSKDYLPEGATDDSPQDL
LPSSGSSGGNPGLFKDLYQVTATITNTGSVTGDEVPQLYVSLGGDDNPSKVLRQFDRVTIAPGQTLQWTTTLTRR
DVSNWDVASQNWVISDAQKKVYVGNSSRKLPLSADLPSVE*
Coding >Pro_DTO377G3_2|g2816.t1
ATGAAGCTCGCGTGGTTTGAGGTAGCCGCCTTGTCGGCCTCGGTGACCAGTGCCAGTTCCCTGGCCTATTCTCCT
CCATACTATCCCTCCCCATGGATGACTGGCGAGGGCGAGTGGTCCGAAGCATACACCCGAGCCGTCGAGTTTGTC
TCAAACCTGACACTGGCCGAAAAAGTCAACTTGACAACCGGTACTGGCTGGGAGCAAGAACGATGTGTTGGTGAG
ACCGGTAGTATTCCCCGACTTGGCATGTGGGGAATGTGTATGCAGGACTCTCCATTGGGTGTTCGCTCTAGTGAT
TACACCTCTGGTTTCCCCTCTGGTGTCAATGTTGCCGCAGCATGGGACAAGCGACTTGCCTACCAGCGCGGTGTG
GCAATGGGAGAAGAGCACCGTGACAAAGGTGTGGATGTGCAACTGGGTCCTGTTGCTGGCCCTCTAGGGAAGAAC
CCTGATGGCGGTCGTAACTGGGAGGGGTTCTCGCCTGATCCCGTTTTGACTGGTGTGATGATGGCCGAAACCATC
AAGGGTATGCAGGATGCCGGTATCATTGCTTGTGCTAAGCACTTCATTGGAAATGAACAGGAACACTTTCGTCAG
CCCGGCGAGGCTCAGGGATTCGGGTACAACATCAGCCAGAGTATGAGCTCAAACATTGACGACAAGACTATGCAC
GAGTTGTACCTCTGGCCCTTCGTGGACTCCATCCGTGCTGGTGTTGGCTCTGTCATGTGTTCCTACAATCAGATC
AATAACAGCTACAGTTGCGCAAACAGCTACTCCCTCAATAAGTTGCTCAAGGGCGAGCTTGGCTTCCAGGGATTT
GTTATGAGCGACTGGGGTGCACACCACAGCGGTGTCGAATCTGCTCTGGCCGGTCTCGATATGTCTATGCCCGGT
GATGTAATTCTCGGTAGCCCTTACTCCTACTGGGCAACCAACTTAACCATCTCCGTTTTAAACGGTACCGTCCCC
GAATGGCGCCTCGATGACATGGCTGTCCGGATAATGTCTGCTTACTACAAGGTTGGACGTGACCGCTTCCGCACT
CCTCCCAACTTCAGCTCCTGGACCCGTGATGAGTACAACTTCGAGCACTCTATGGTAAGCGAGGGCTGGGGCAAG
GTCAACGAGCACGTAAATGTCCAGCGTGACCATGCCCAGATCATCCGCAAGATTGGCTCTGACAGCATTGTTCTG
CTTAAGAACAAGGCTGGTGCACTGCCCCTTACCCATGATGAGAGATTCATCGGCATTATAGGAGAAGACGCAGGC
TCCAATGCCTATGGCGCCAATGGCTGCAGCGACCGTGGTTGTGACAACGGAACTTTGGCCATGGGCTGGGGTAGT
GGAACCGCCAACTTTCCTTACCTGATTACACCCGAGCAAGCCATCCAAAATGAAGTCCTGGAATACAGTAACGGA
CAGACCAACGTCTTCGCTGTGACTGATAACTGGGCCCTCACGGAGATGGCCGCCCTTGCCTCCCAGGCTGATGTT
GCCCTGGTTTTCGTGAACGCCGACGCTGGTGAGGGATACATCAGCGTTGACGGCAACGAGGGTGACCGCAAGAAC
CTGACGCTCTGGAAGAACGGAGAGGAGATCATCAAAGCTGCTAGTCAGCACTGCAACAACACTATCGTCGTGATT
CACAGTACATCCGCTGTTCTGATTAGCGATTGGTATGACAATGTCAACATTACCGCCATTGTTTGGGCTGGCTTG
CCAGGCCAGGAGAGCGGTCGGAGCTTGGTGGACGTATTGTATGGTCGCGTCAACCCTGGCGGTAAGACTCCATTT
ACCTGGGGTAAGACTCGCAAGGACTACGGCCCTCCTATCCTCACGGTGCCCAATAACGGTGTCGATGCTCCTCAG
GTTAATTTTGAGGATGGCGTCTTCATTGACTATCGCCGTTTCGATAAAGACAATACGGAGCCCATCTACGAGTTC
GGTTATGGTCTGAGCTACACAAATTTTGCCTTCTCCGACCTCAAGGTCACCCCTCTAGCCTCATCCGAACAGCGC
GAGTACAAGGCGACGACTGGAAAGAGCCAAAAGGCCCCTGTTCTCGGCGAAGCCGGCAAGGTCTTGGATAACCTG
TTCCCCGAGGGAATTACACGCGTCCGCCAGTACCTTTACCCGTGGTTGAACTCCACCGACTTACGTGCATCGTCC
GGTGATCCCGACTACGGCATGGACTCCAAGGACTACCTTCCTGAGGGTGCTACCGATGATTCTCCGCAGGACCTT
CTTCCCTCTAGCGGCAGCTCCGGCGGCAACCCTGGTCTGTTCAAAGATCTCTACCAAGTGACCGCCACTATCACT
AACACCGGCTCCGTAACTGGTGACGAGGTTCCTCAGTTGTATGTCTCCCTCGGCGGCGATGATAACCCCTCAAAG
GTTTTGCGCCAGTTTGACCGAGTCACCATTGCCCCTGGTCAGACCCTGCAGTGGACCACCACTCTGACCCGTCGT
GATGTCTCCAACTGGGACGTTGCCTCACAGAACTGGGTGATCTCCGACGCCCAGAAGAAGGTGTATGTCGGCAAC
TCATCCCGCAAGTTGCCACTATCGGCCGACTTGCCCTCGGTTGAGTAA
Transcript >Pro_DTO377G3_2|g2816.t1
ATGAAGCTCGCGTGGTTTGAGGTAGCCGCCTTGTCGGCCTCGGTGACCAGTGCCAGTTCCCTGGCCTATTCTCCT
CCATACTATCCCTCCCCATGGATGACTGGCGAGGGCGAGTGGTCCGAAGCATACACCCGAGCCGTCGAGTTTGTC
TCAAACCTGACACTGGCCGAAAAAGTCAACTTGACAACCGGTACTGGCTGGGAGCAAGAACGATGTGTTGGTGAG
ACCGGTAGTATTCCCCGACTTGGCATGTGGGGAATGTGTATGCAGGACTCTCCATTGGGTGTTCGCTCTAGTGAT
TACACCTCTGGTTTCCCCTCTGGTGTCAATGTTGCCGCAGCATGGGACAAGCGACTTGCCTACCAGCGCGGTGTG
GCAATGGGAGAAGAGCACCGTGACAAAGGTGTGGATGTGCAACTGGGTCCTGTTGCTGGCCCTCTAGGGAAGAAC
CCTGATGGCGGTCGTAACTGGGAGGGGTTCTCGCCTGATCCCGTTTTGACTGGTGTGATGATGGCCGAAACCATC
AAGGGTATGCAGGATGCCGGTATCATTGCTTGTGCTAAGCACTTCATTGGAAATGAACAGGAACACTTTCGTCAG
CCCGGCGAGGCTCAGGGATTCGGGTACAACATCAGCCAGAGTATGAGCTCAAACATTGACGACAAGACTATGCAC
GAGTTGTACCTCTGGCCCTTCGTGGACTCCATCCGTGCTGGTGTTGGCTCTGTCATGTGTTCCTACAATCAGATC
AATAACAGCTACAGTTGCGCAAACAGCTACTCCCTCAATAAGTTGCTCAAGGGCGAGCTTGGCTTCCAGGGATTT
GTTATGAGCGACTGGGGTGCACACCACAGCGGTGTCGAATCTGCTCTGGCCGGTCTCGATATGTCTATGCCCGGT
GATGTAATTCTCGGTAGCCCTTACTCCTACTGGGCAACCAACTTAACCATCTCCGTTTTAAACGGTACCGTCCCC
GAATGGCGCCTCGATGACATGGCTGTCCGGATAATGTCTGCTTACTACAAGGTTGGACGTGACCGCTTCCGCACT
CCTCCCAACTTCAGCTCCTGGACCCGTGATGAGTACAACTTCGAGCACTCTATGGTAAGCGAGGGCTGGGGCAAG
GTCAACGAGCACGTAAATGTCCAGCGTGACCATGCCCAGATCATCCGCAAGATTGGCTCTGACAGCATTGTTCTG
CTTAAGAACAAGGCTGGTGCACTGCCCCTTACCCATGATGAGAGATTCATCGGCATTATAGGAGAAGACGCAGGC
TCCAATGCCTATGGCGCCAATGGCTGCAGCGACCGTGGTTGTGACAACGGAACTTTGGCCATGGGCTGGGGTAGT
GGAACCGCCAACTTTCCTTACCTGATTACACCCGAGCAAGCCATCCAAAATGAAGTCCTGGAATACAGTAACGGA
CAGACCAACGTCTTCGCTGTGACTGATAACTGGGCCCTCACGGAGATGGCCGCCCTTGCCTCCCAGGCTGATGTT
GCCCTGGTTTTCGTGAACGCCGACGCTGGTGAGGGATACATCAGCGTTGACGGCAACGAGGGTGACCGCAAGAAC
CTGACGCTCTGGAAGAACGGAGAGGAGATCATCAAAGCTGCTAGTCAGCACTGCAACAACACTATCGTCGTGATT
CACAGTACATCCGCTGTTCTGATTAGCGATTGGTATGACAATGTCAACATTACCGCCATTGTTTGGGCTGGCTTG
CCAGGCCAGGAGAGCGGTCGGAGCTTGGTGGACGTATTGTATGGTCGCGTCAACCCTGGCGGTAAGACTCCATTT
ACCTGGGGTAAGACTCGCAAGGACTACGGCCCTCCTATCCTCACGGTGCCCAATAACGGTGTCGATGCTCCTCAG
GTTAATTTTGAGGATGGCGTCTTCATTGACTATCGCCGTTTCGATAAAGACAATACGGAGCCCATCTACGAGTTC
GGTTATGGTCTGAGCTACACAAATTTTGCCTTCTCCGACCTCAAGGTCACCCCTCTAGCCTCATCCGAACAGCGC
GAGTACAAGGCGACGACTGGAAAGAGCCAAAAGGCCCCTGTTCTCGGCGAAGCCGGCAAGGTCTTGGATAACCTG
TTCCCCGAGGGAATTACACGCGTCCGCCAGTACCTTTACCCGTGGTTGAACTCCACCGACTTACGTGCATCGTCC
GGTGATCCCGACTACGGCATGGACTCCAAGGACTACCTTCCTGAGGGTGCTACCGATGATTCTCCGCAGGACCTT
CTTCCCTCTAGCGGCAGCTCCGGCGGCAACCCTGGTCTGTTCAAAGATCTCTACCAAGTGACCGCCACTATCACT
AACACCGGCTCCGTAACTGGTGACGAGGTTCCTCAGTTGTATGTCTCCCTCGGCGGCGATGATAACCCCTCAAAG
GTTTTGCGCCAGTTTGACCGAGTCACCATTGCCCCTGGTCAGACCCTGCAGTGGACCACCACTCTGACCCGTCGT
GATGTCTCCAACTGGGACGTTGCCTCACAGAACTGGGTGATCTCCGACGCCCAGAAGAAGGTGTATGTCGGCAAC
TCATCCCGCAAGTTGCCACTATCGGCCGACTTGCCCTCGGTTGAGTAA
Gene >Pro_DTO377G3_2|g2816.t1
ATGAAGCTCGCGTGGTTTGAGGTAGCCGCCTTGTCGGCCTCGGTGACCAGTGCCAGTGTGAGTCCAATTTAAACG
GTTGACAATATCACTGCTAACCAAGTCACATGAAAATAGTCCCTGGCCTATTCTCCTCCATACTATCCCTCCCCA
TGGATGACTGGCGAGGGCGAGTGGTCCGAAGCATACACCCGAGCCGTCGAGTTTGTCTCAAACCTGACACTGGCC
GAAAAAGTCAACTTGACAACCGGTACTGGCTGGGAGCAAGAACGATGTGTTGGTGAGACCGGTAGTATTCCCCGA
CTTGGCATGTGGGGAATGTGTATGCAGGACTCTCCATTGGGTGTTCGCTCTAGTAAGCTTGCCAGTTCCAAATAA
GCTTGTCGTTGCGGTTAACTAATGAGACTGGAACAGGTGATTACACCTCTGGTTTCCCCTCTGGTGTCAATGTTG
CCGCAGCATGGGACAAGCGACTTGCCTACCAGCGCGGTGTGGCAATGGGAGAAGAGCACCGTGACAAAGGTGTGG
ATGTGCAACTGGGTCCTGTTGCTGGCCCTCTAGGGAAGAACCCTGATGGCGGTCGTAACTGGGAGGGGTTCTCGC
CTGATCCCGTTTTGACTGGTGTGATGATGGCCGAAACCATCAAGGGTATGCAGGATGCCGGTATCATTGCTTGTG
CTAAGCACTTCATTGGAAATGAACAGGAACACTTTCGTCAGCCCGGCGAGGCTCAGGGATTCGGGTACAACATCA
GCCAGAGTATGAGCTCAAACATTGACGACAAGACTATGCACGAGTTGTACCTCTGGCCCTTCGTGGACTCCATCC
GTGCTGGTGTTGGCTCTGTCATGTGTTCCTACAATCAGATCAATAACAGCTACAGTTGCGCAAACAGCTACTCCC
TCAATAAGTTGCTCAAGGGCGAGCTTGGCTTCCAGGGATTTGTTATGAGCGACTGGGGTGCACACCACAGCGGTG
TCGAATCTGCTCTGGCCGGTCTCGATATGTCTATGCCCGGTGATGTAATTCTCGGTAGCCCTTACTCCTACTGGG
CAACCAACTTAACCATCTCCGTTTTAAACGGTACCGTCCCCGAATGGCGCCTCGATGACATGGCTGTCCGGATAA
TGTCTGCTTACTACAAGGTTGGACGTGACCGCTTCCGCACTCCTCCCAACTTCAGCTCCTGGACCCGTGATGAGT
ACAACTTCGAGCACTCTATGGTAAGCGAGGGCTGGGGCAAGGTCAACGAGCACGTAAATGTCCAGCGTGACCATG
CCCAGATCATCCGCAAGATTGGCTCTGACAGCATTGTTCTGCTTAAGAACAAGGCTGGTGCACTGCCCCTTACCC
ATGATGAGAGATTCATCGGCATTATAGGAGAAGACGCAGGCTCCAATGCCTATGGCGCCAATGGCTGCAGCGACC
GTGGTTGTGACAACGGAACTTTGGCCATGGGCTGGGGTAGTGGAACCGCCAACTTTCCTTACCTGATTACACCCG
AGCAAGCCATCCAAAATGAAGTCCTGGAATACAGTAACGGACAGACCAACGTCTTCGCTGTGACTGATAACTGGG
CCCTCACGGAGATGGCCGCCCTTGCCTCCCAGGCTGATGTTGCCCTGGTTTTCGTGAACGCCGACGCTGGTGAGG
GATACATCAGCGTTGACGGCAACGAGGGTGACCGCAAGAACCTGACGCTCTGGAAGAACGGAGAGGAGATCATCA
AAGCTGCTAGTCAGCACTGCAACAACACTATCGTCGTGATTCACAGTACATCCGCTGTTCTGATTAGCGATTGGT
ATGACAATGTCAACATTACCGCCATTGTTTGGGCTGGCTTGCCAGGCCAGGAGAGCGGTCGGAGCTTGGTGGACG
TATTGTATGGTCGCGTCAACCCTGGCGGTAAGACTCCATTTACCTGGGGTAAGACTCGCAAGGACTACGGCCCTC
CTATCCTCACGGTGCCCAATAACGGTGTCGATGCTCCTCAGGTTAATTTTGAGGATGGCGTCTTCATTGACTATC
GCCGTTTCGATAAAGACAATACGGAGCCCATCTACGAGTTCGGTTATGGTCTGAGCTACACAAATTTTGCCTTCT
CCGACCTCAAGGTCACCCCTCTAGCCTCATCCGAACAGCGCGAGTACAAGGCGACGACTGGAAAGAGCCAAAAGG
CCCCTGTTCTCGGCGAAGCCGGCAAGGTCTTGGATAACCTGTTCCCCGAGGGAATTACACGCGTCCGCCAGTACC
TTTACCCGTGGTTGAACTCCACCGACTTACGTGCATCGTCCGGTGATCCCGACTACGGCATGGACTCCAAGGACT
ACCTTCCTGAGGGTGCTACCGATGATTCTCCGCAGGACCTTCTTCCCTCTAGCGGCAGCTCCGGCGGCAACCCTG
GTCTGTTCAAAGATCTCTACCAAGTGACCGCCACTATCACTAACACCGGCTCCGTAACTGGTGACGAGGTTCCTC
AGTTGTATGTCTCCCTCGGCGGCGATGATAACCCCTCAAAGGTTTTGCGCCAGTTTGACCGAGTCACCATTGCCC
CTGGTCAGACCCTGCAGTGGACCACCACTCTGACCCGTCGTGATGTCTCCAACTGGGACGTTGCCTCACAGAACT
GGGTGATCTCCGACGCCCAGAAGAAGGTGTATGTCGGCAACTCATCCCGCAAGTTGCCACTATCGGCCGACTTGC
CCTCGGTTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail