Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2800.t1
Gene name
Locationscaffold_03:992190..993609
Strand-
Gene length (bp)1419
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 2.7E-47 5 205
PF01764 Lipase_3 Lipase (class 3) 2.6E-05 62 130

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 264 286 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 93.06 56.94 129.18
5d_25C Five days - 25 degrees Celsius 64.99 38.96 91.03
7d_25C Seven days - 25 degrees Celsius 74.91 45.52 104.30
10d_25C Ten days - 25 degrees Celsius 61.81 37.09 86.52
7d_15C Seven days - 15 degrees Celsius 72.22 43.87 100.57
7d_30C Seven days - 30 degrees Celsius 40.47 22.73 58.20

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.106607 no
3d_25C 7d_25C 0.368860 no
3d_25C 7d_15C 0.276108 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.055491 no
5d_25C 7d_25C 0.608734 no
5d_25C 7d_15C 0.721475 no
5d_25C 7d_30C 0.035243 yes
5d_25C 10d_25C 0.879797 no
7d_25C 7d_15C 0.914707 no
7d_25C 7d_30C 0.005235 yes
7d_25C 10d_25C 0.451452 no
7d_15C 7d_30C 0.008469 yes
7d_15C 10d_25C 0.560862 no
7d_30C 10d_25C 0.067945 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2800.t1
MAGTSKADHLCVLVHGLWGNPSHLDYIASALRDRYGGENLYILCPKTNSGNYTYDGIELGGERIVHEVEETLESL
AKKGQKITKISVVGYSLGGLLARYAIGLLNARGWLDKLEPMNFTTFATPHVGVRAPLKGYKDQIFNVLGPRTISA
SGRQMWLVDSFRDTGRPLLSVLADPESIFITGLKKFRHRSVYANIVNDRSVLFYTSGLSKVDPFRDLEDVNINYV
KGYEDVIIDPDMHVLPPVERNPETAAARFWKKIKSLTLWVPLSLLIIVLSPLACTLFLVNAGIQTFRSSKRIRMH
EIGENGERFGRYRVPVLVQDVQHVVEQAFDNVNAIQEPAYLSNSDTEVSDAAPEKPARSSVSKSAQSDDTESASA
RRSSTTEVSVHCPQLALTPEQFGIIDSLNAVGIRKYPVHIQKHHHSHAAIIVRVEKDGFREGKIVMKHWLDNEFA
L*
Coding >Pro_DTO377G3_2|g2800.t1
ATGGCAGGTACTTCCAAAGCCGACCATCTCTGTGTCTTAGTTCACGGACTTTGGGGAAACCCTTCGCACCTTGAT
TACATCGCATCCGCTCTAAGAGACAGATATGGCGGCGAAAACCTCTACATCCTCTGCCCAAAAACAAATAGCGGC
AACTATACCTACGACGGAATCGAGTTGGGCGGAGAACGAATAGTGCACGAGGTCGAGGAGACTCTTGAATCTCTA
GCCAAGAAGGGACAAAAGATCACGAAAATCAGTGTGGTTGGATACTCGCTTGGTGGTCTGCTCGCGCGCTATGCG
ATCGGCCTGCTCAATGCACGGGGTTGGCTGGATAAGCTGGAACCTATGAATTTCACGACCTTTGCCACACCACAC
GTTGGAGTGAGAGCTCCACTGAAAGGATACAAGGATCAGATTTTCAATGTTTTAGGGCCGAGGACGATCTCGGCA
TCTGGCCGCCAAATGTGGCTGGTCGATTCCTTCCGGGATACCGGGCGGCCGCTTCTCTCTGTTTTGGCTGATCCC
GAGAGCATCTTCATAACTGGATTGAAGAAGTTCCGGCACCGCAGTGTCTATGCGAATATCGTCAATGATCGCTCA
GTTCTCTTCTATACATCTGGTCTCTCTAAAGTGGACCCATTCCGGGATCTGGAAGACGTGAATATCAACTACGTC
AAGGGTTATGAAGATGTCATTATCGATCCTGACATGCATGTGCTTCCACCGGTGGAAAGAAACCCCGAAACCGCA
GCAGCGCGATTCTGGAAGAAGATAAAATCGTTGACTCTTTGGGTACCTCTGTCACTCTTGATCATTGTTCTCTCG
CCTCTGGCTTGTACACTCTTCCTGGTAAATGCCGGGATCCAGACGTTTCGCAGTTCAAAGCGAATTCGTATGCAT
GAAATTGGCGAAAACGGCGAGCGCTTTGGAAGATACAGAGTACCGGTTTTGGTCCAAGATGTTCAGCATGTCGTG
GAGCAGGCCTTTGATAACGTCAATGCTATACAAGAACCCGCTTACCTGTCCAACAGCGATACTGAGGTGTCTGAT
GCGGCGCCTGAGAAGCCCGCTAGATCGTCTGTCTCGAAGTCCGCGCAAAGCGATGACACTGAGTCTGCGTCGGCT
AGACGTTCATCAACGACGGAGGTTTCGGTGCATTGTCCTCAGCTTGCATTGACTCCCGAACAATTTGGCATCATT
GATTCCCTCAACGCCGTGGGAATTCGGAAATATCCCGTCCACATACAGAAGCACCACCACAGCCACGCAGCTATC
ATCGTCCGGGTTGAGAAGGATGGGTTCCGAGAGGGTAAGATTGTGATGAAGCATTGGCTAGACAATGAGTTCGCG
TTGTAA
Transcript >Pro_DTO377G3_2|g2800.t1
ATGGCAGGTACTTCCAAAGCCGACCATCTCTGTGTCTTAGTTCACGGACTTTGGGGAAACCCTTCGCACCTTGAT
TACATCGCATCCGCTCTAAGAGACAGATATGGCGGCGAAAACCTCTACATCCTCTGCCCAAAAACAAATAGCGGC
AACTATACCTACGACGGAATCGAGTTGGGCGGAGAACGAATAGTGCACGAGGTCGAGGAGACTCTTGAATCTCTA
GCCAAGAAGGGACAAAAGATCACGAAAATCAGTGTGGTTGGATACTCGCTTGGTGGTCTGCTCGCGCGCTATGCG
ATCGGCCTGCTCAATGCACGGGGTTGGCTGGATAAGCTGGAACCTATGAATTTCACGACCTTTGCCACACCACAC
GTTGGAGTGAGAGCTCCACTGAAAGGATACAAGGATCAGATTTTCAATGTTTTAGGGCCGAGGACGATCTCGGCA
TCTGGCCGCCAAATGTGGCTGGTCGATTCCTTCCGGGATACCGGGCGGCCGCTTCTCTCTGTTTTGGCTGATCCC
GAGAGCATCTTCATAACTGGATTGAAGAAGTTCCGGCACCGCAGTGTCTATGCGAATATCGTCAATGATCGCTCA
GTTCTCTTCTATACATCTGGTCTCTCTAAAGTGGACCCATTCCGGGATCTGGAAGACGTGAATATCAACTACGTC
AAGGGTTATGAAGATGTCATTATCGATCCTGACATGCATGTGCTTCCACCGGTGGAAAGAAACCCCGAAACCGCA
GCAGCGCGATTCTGGAAGAAGATAAAATCGTTGACTCTTTGGGTACCTCTGTCACTCTTGATCATTGTTCTCTCG
CCTCTGGCTTGTACACTCTTCCTGGTAAATGCCGGGATCCAGACGTTTCGCAGTTCAAAGCGAATTCGTATGCAT
GAAATTGGCGAAAACGGCGAGCGCTTTGGAAGATACAGAGTACCGGTTTTGGTCCAAGATGTTCAGCATGTCGTG
GAGCAGGCCTTTGATAACGTCAATGCTATACAAGAACCCGCTTACCTGTCCAACAGCGATACTGAGGTGTCTGAT
GCGGCGCCTGAGAAGCCCGCTAGATCGTCTGTCTCGAAGTCCGCGCAAAGCGATGACACTGAGTCTGCGTCGGCT
AGACGTTCATCAACGACGGAGGTTTCGGTGCATTGTCCTCAGCTTGCATTGACTCCCGAACAATTTGGCATCATT
GATTCCCTCAACGCCGTGGGAATTCGGAAATATCCCGTCCACATACAGAAGCACCACCACAGCCACGCAGCTATC
ATCGTCCGGGTTGAGAAGGATGGGTTCCGAGAGGGTAAGATTGTGATGAAGCATTGGCTAGACAATGAGTTCGCG
TTGTAA
Gene >Pro_DTO377G3_2|g2800.t1
ATGGCAGGTACTTCCAAAGCCGACCATCTCTGTGTCTTAGTTCACGGGTACGCTGTATTCTCCTTCTCAATGACG
TACTGACGAGCCGCTAACGCAAATCTCCCCAATAGACTTTGGGGAAACCCTTCGCACCTTGATTACATCGCATCC
GCTCTAAGAGACAGATATGGCGGCGAAAACCTCTACATCCTCTGCCCAAAAACAAATAGCGGCAACTATACCTAC
GACGGAATCGAGTTGGGCGGAGAACGAATAGTGCACGAGGTCGAGGAGACTCTTGAATCTCTAGCCAAGAAGGGA
CAAAAGATCACGAAAATCAGTGTGGTTGGATACTCGCTTGGTGGTCTGCTCGCGCGCTATGCGATCGGCCTGCTC
AATGCACGGGGTTGGCTGGATAAGCTGGAACCTATGAATTTCACGACCTTTGCCACACCACACGTTGGAGTGAGA
GCTCCACTGAAAGGATACAAGGATCAGATTTTCAATGTTTTAGGGCCGAGGACGATCTCGGCATCTGGCCGCCAA
ATGTGGCTGGTCGATTCCTTCCGGGATACCGGGCGGCCGCTTCTCTCTGTTTTGGCTGATCCCGAGAGCATCTTC
ATAACTGGATTGAAGAAGTTCCGGCACCGCAGTGTCTATGCGAATATCGTCAATGATCGCTCAGTTCTCTTCTAT
ACATCTGGTCTCTCTAAAGTGGACCCATTCCGGGATCTGGAAGACGTGAATATCAACTACGTCAAGGGTTATGAA
GATGTCATTATCGATCCTGACATGCATGTGCTTCCACCGGTGGAAAGAAACCCCGAAACCGCAGCAGCGCGATTC
TGGAAGAAGATAAAATCGTTGACTCTTTGGGTACCTCTGTCACTCTTGATCATTGTTCTCTCGCCTCTGGCTTGT
ACACTCTTCCTGGTAAATGCCGGGATCCAGACGTTTCGCAGTTCAAAGCGAATTCGTATGCATGAAATTGGCGAA
AACGGCGAGCGCTTTGGAAGATACAGAGTACCGGTTTTGGTCCAAGATGTTCAGCATGTCGTGGAGCAGGCCTTT
GATAACGTCAATGCTATACAAGAACCCGCTTACCTGTCCAACAGCGATACTGAGGTGTCTGATGCGGCGCCTGAG
AAGCCCGCTAGATCGTCTGTCTCGAAGTCCGCGCAAAGCGATGACACTGAGTCTGCGTCGGCTAGACGTTCATCA
ACGACGGAGGTTTCGGTGCATTGTCCTCAGCTTGCATTGACTCCCGAACAATTTGGCATCATTGATTCCCTCAAC
GCCGTGGGAATTCGGAAATATCCCGTCCACATACAGAAGCACCACCACAGCCACGCAGCTATCATCGTCCGGGTT
GAGAAGGATGGGTTCCGAGAGGGTAAGATTGTGATGAAGCATTGGCTAGACAATGAGTTCGCGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail