Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2799.t1
Gene name
Locationscaffold_03:990042..991414
Strand+
Gene length (bp)1372
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 2.4E-21 68 172
PF13242 Hydrolase_like HAD-hyrolase-like 1.1E-11 298 384

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 229.15 137.97 320.32
5d_25C Five days - 25 degrees Celsius 303.57 180.35 426.79
7d_25C Seven days - 25 degrees Celsius 354.09 206.14 502.04
10d_25C Ten days - 25 degrees Celsius 624.14 347.95 900.32
7d_15C Seven days - 15 degrees Celsius 273.78 161.67 385.89
7d_30C Seven days - 30 degrees Celsius 286.76 167.11 406.41

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.232457 no
3d_25C 7d_25C 0.044177 yes
3d_25C 7d_15C 0.491949 no
3d_25C 7d_30C 0.375285 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.575957 no
5d_25C 7d_15C 0.725749 no
5d_25C 7d_30C 0.863146 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.287707 no
7d_25C 7d_30C 0.407330 no
7d_25C 10d_25C 0.009124 yes
7d_15C 7d_30C 0.892671 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2799.t1
MATDRSGTQRVTDLHGPNVVFKHSMIFTPDNIFNSNMAKQDQVSSEESPINTPMTNPPKVTSDDFALAFDIDGVL
IKGGEPIPEAVDAMKYINGENPYGVKVPYIFLTNGGGKTEKERCLDLSKQLDLEVDPGQFICGHTPMREMAERYN
TVLVVGGEGEKCRVVAEGYGFKDVITPGDIIKTRHDTTPFRTLTDEEHQNSRLLDLDKVRIEAIFVFADSRDWAG
DQQIILDCLMSKDGWLNKRSEIFTEGPPVFFSHTDVVWSTSHEHSRLGMGALRASLEAVYAAITGKDLNTTAFGK
PQLGTYGFATRLLQKWRKDSCGIDKSPSTVYFIGDTPESDIRGTNEFNETTENDWFSILVKTGVYQDGAVPRYPP
RKICDNVFDAVKFAIEREHRKTSKGITVSELDYDISEAPPK*
Coding >Pro_DTO377G3_2|g2799.t1
ATGGCCACAGATAGATCAGGAACTCAAAGGGTGACCGATCTCCATGGGCCTAACGTCGTCTTTAAGCATTCGATG
ATTTTCACTCCTGACAATATCTTCAACTCAAATATGGCCAAGCAGGATCAAGTATCATCTGAGGAATCTCCAATC
AACACCCCTATGACGAACCCTCCTAAGGTTACTAGCGATGATTTCGCCCTAGCCTTCGATATCGATGGCGTTCTG
ATCAAGGGCGGCGAGCCTATTCCCGAAGCCGTTGATGCTATGAAGTATATCAACGGCGAAAACCCCTACGGAGTC
AAAGTTCCTTATATTTTCTTGACCAACGGCGGCGGGAAGACAGAGAAAGAGCGATGCCTGGACCTCAGCAAACAA
CTCGACCTGGAAGTCGACCCTGGCCAGTTTATCTGTGGCCACACGCCCATGCGCGAAATGGCAGAGCGATACAAC
ACCGTCCTGGTGGTTGGTGGCGAGGGTGAAAAATGCCGGGTCGTGGCTGAAGGATATGGATTCAAGGATGTCATC
ACACCCGGAGATATCATTAAGACGAGACACGATACTACGCCATTCCGAACGCTGACGGATGAGGAGCACCAAAAT
TCCCGGCTGCTCGATTTAGACAAGGTCCGCATCGAAGCGATCTTCGTCTTTGCAGATAGTCGCGACTGGGCTGGT
GACCAGCAAATCATTTTGGACTGCCTCATGAGCAAAGACGGCTGGTTGAATAAACGGTCGGAGATCTTCACTGAA
GGCCCACCTGTCTTCTTCTCGCACACCGATGTGGTTTGGTCAACATCGCATGAACATTCACGTCTTGGGATGGGA
GCGCTGCGCGCTTCCCTCGAGGCTGTTTACGCGGCTATCACAGGCAAAGACCTCAACACTACTGCTTTCGGTAAG
CCGCAGCTCGGAACCTATGGATTTGCCACCCGGCTTTTGCAAAAGTGGCGAAAGGACTCGTGTGGCATCGACAAG
TCTCCGTCTACCGTGTACTTCATTGGCGATACTCCGGAATCCGACATCCGTGGCACAAATGAATTTAACGAGACT
ACGGAAAATGACTGGTTCTCCATTCTGGTTAAGACTGGAGTCTACCAGGATGGTGCTGTCCCACGCTATCCACCC
AGAAAGATATGCGATAATGTTTTTGATGCCGTCAAGTTTGCTATCGAGCGCGAGCATCGAAAGACTTCCAAAGGA
ATAACTGTTTCCGAGCTCGACTATGACATCAGCGAAGCACCTCCCAAATAA
Transcript >Pro_DTO377G3_2|g2799.t1
ATGGCCACAGATAGATCAGGAACTCAAAGGGTGACCGATCTCCATGGGCCTAACGTCGTCTTTAAGCATTCGATG
ATTTTCACTCCTGACAATATCTTCAACTCAAATATGGCCAAGCAGGATCAAGTATCATCTGAGGAATCTCCAATC
AACACCCCTATGACGAACCCTCCTAAGGTTACTAGCGATGATTTCGCCCTAGCCTTCGATATCGATGGCGTTCTG
ATCAAGGGCGGCGAGCCTATTCCCGAAGCCGTTGATGCTATGAAGTATATCAACGGCGAAAACCCCTACGGAGTC
AAAGTTCCTTATATTTTCTTGACCAACGGCGGCGGGAAGACAGAGAAAGAGCGATGCCTGGACCTCAGCAAACAA
CTCGACCTGGAAGTCGACCCTGGCCAGTTTATCTGTGGCCACACGCCCATGCGCGAAATGGCAGAGCGATACAAC
ACCGTCCTGGTGGTTGGTGGCGAGGGTGAAAAATGCCGGGTCGTGGCTGAAGGATATGGATTCAAGGATGTCATC
ACACCCGGAGATATCATTAAGACGAGACACGATACTACGCCATTCCGAACGCTGACGGATGAGGAGCACCAAAAT
TCCCGGCTGCTCGATTTAGACAAGGTCCGCATCGAAGCGATCTTCGTCTTTGCAGATAGTCGCGACTGGGCTGGT
GACCAGCAAATCATTTTGGACTGCCTCATGAGCAAAGACGGCTGGTTGAATAAACGGTCGGAGATCTTCACTGAA
GGCCCACCTGTCTTCTTCTCGCACACCGATGTGGTTTGGTCAACATCGCATGAACATTCACGTCTTGGGATGGGA
GCGCTGCGCGCTTCCCTCGAGGCTGTTTACGCGGCTATCACAGGCAAAGACCTCAACACTACTGCTTTCGGTAAG
CCGCAGCTCGGAACCTATGGATTTGCCACCCGGCTTTTGCAAAAGTGGCGAAAGGACTCGTGTGGCATCGACAAG
TCTCCGTCTACCGTGTACTTCATTGGCGATACTCCGGAATCCGACATCCGTGGCACAAATGAATTTAACGAGACT
ACGGAAAATGACTGGTTCTCCATTCTGGTTAAGACTGGAGTCTACCAGGATGGTGCTGTCCCACGCTATCCACCC
AGAAAGATATGCGATAATGTTTTTGATGCCGTCAAGTTTGCTATCGAGCGCGAGCATCGAAAGACTTCCAAAGGA
ATAACTGTTTCCGAGCTCGACTATGACATCAGCGAAGCACCTCCCAAATAA
Gene >Pro_DTO377G3_2|g2799.t1
ATGGCCACAGATAGATCAGGAACTCAAAGGGTGACCGATCTCCATGGGCCTAACGTCGTCTTTAAGCATTCGATG
ATTTTCACTCCTGACAATATCTTCAACTCAAATATGGCCAAGCAGGATCAAGTATCATCTGAGGAATCTCCAATC
AACACCCCTATGACGAACCCTCCTAAGGTTACTAGCGATGATTTCGCCCTAGCCTTCGATATCGATGGCGTTCTG
ATCAAGGGCGGCGAGCCTATTCCCGAAGCCGTTGATGCTATGAAGTATATCAACGGCGAAAACCCCTACGGAGTC
AAAGTGTAAGTATTTGCCCTGGTGTTATTTCCATGGTTCCTCACCCAGGACAGGGCGAGGGGAAACAGTTGCGAG
CAAAAAAAGAAAAGACGGAAAAGGAATTTGAATCTAACGGCAACATTATAGTCCTTATATTTTCTTGACCAACGG
CGGCGGGAAGACAGAGAAAGAGCGATGCCTGGACCTCAGCAAACAACTCGACCTGGAAGTCGACCCTGGCCAGTT
TATCTGTGGCCACACGCCCATGCGCGAAATGGCAGAGCGATACAACACCGTCCTGGTGGTTGGTGGCGAGGGTGA
AAAATGCCGGGTCGTGGCTGAAGGATATGGATTCAAGGATGTCATCACACCCGGAGATATCATTAAGACGAGACA
CGATACTACGCCATTCCGAACGCTGACGGATGAGGAGCACCAAAATTCCCGGCTGCTCGATTTAGACAAGGTCCG
CATCGAAGCGATCTTCGTCTTTGCAGATAGTCGCGACTGGGCTGGTGACCAGCAAATCATTTTGGACTGCCTCAT
GAGCAAAGACGGCTGGTTGAATAAACGGTCGGAGATCTTCACTGAAGGCCCACCTGTCTTCTTCTCGCACACCGA
TGTGGTTTGGTCAACATCGCATGAACATTCACGTCTTGGGATGGGAGCGCTGCGCGCTTCCCTCGAGGCTGTTTA
CGCGGCTATCACAGGCAAAGACCTCAACACTACTGCTTTCGGTAAGCCGCAGCTCGGAACCTATGGATTTGCCAC
CCGGCTTTTGCAAAAGTGGCGAAAGGACTCGTGTGGCATCGACAAGTCTCCGTCTACCGTGTACTTCATTGGCGA
TACTCCGGAATCCGACATCCGTGGCACAAATGAATTTAACGAGACTACGGAAAATGACTGGTTCTCCATTCTGGT
TAAGACTGGAGTCTACCAGGATGGTGCTGTCCCACGCTATCCACCCAGAAAGATATGCGATAATGTTTTTGATGC
CGTCAAGTTTGCTATCGAGCGCGAGCATCGAAAGACTTCCAAAGGAATAACTGTTTCCGAGCTCGACTATGACAT
CAGCGAAGCACCTCCCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail