Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2797.t1
Gene name
Locationscaffold_03:983865..986258
Strand+
Gene length (bp)2393
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 285 307 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.84 4.01 13.67
5d_25C Five days - 25 degrees Celsius 9.81 4.56 15.06
7d_25C Seven days - 25 degrees Celsius 12.24 6.02 18.46
10d_25C Ten days - 25 degrees Celsius 12.00 5.81 18.19
7d_15C Seven days - 15 degrees Celsius 11.12 5.36 16.89
7d_30C Seven days - 30 degrees Celsius 8.73 3.90 13.56

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.803038 no
3d_25C 7d_25C 0.290243 no
3d_25C 7d_15C 0.508245 no
3d_25C 7d_30C 0.981280 no
3d_25C 10d_25C 0.342746 no
5d_25C 7d_25C 0.513634 no
5d_25C 7d_15C 0.751579 no
5d_25C 7d_30C 0.782764 no
5d_25C 10d_25C 0.576870 no
7d_25C 7d_15C 0.809435 no
7d_25C 7d_30C 0.289422 no
7d_25C 10d_25C 0.965632 no
7d_15C 7d_30C 0.494026 no
7d_15C 10d_25C 0.857092 no
7d_30C 10d_25C 0.330971 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2797.t1
MARRVSETPTRPTILIGRYTITTIRLLKWGYWSPSFWNFTTFTYATQFADTSTNYGISKGYHSMLLLPIHRILIA
ILLLSTLCSAAENASSDAANSALYDMVPDCAKDCVDSFIMSEYTFIECTSPSNIKCLCRTKTTSSLTLGEAALSC
VLSVCSQTVIAKSKAYHICDSVSEALPKTHQTITATVFSDTSTTKTSDAKTSRETTPTISTSTTEHTSEASMGTS
IATSTSTPTSTTSQTSEITFYAASSSSGSQVEPTSSTGQISSDSSEDTNKKGDHGITPAAIIGMSVASGVAGFFI
IGVAVFFCCKRWRRKQREQTAPHIFEIGGAMSEPPDFSKPMPRLPTNGLGLESSYSPTSDRETMAQRPRTFHSMA
SVQPPRYSPQYAKVHHLGQSKEPTDQERIGFAISSDSDWETSPRTQSSQHSIARLLPDPIAGLYPKPLKWSHRPP
SGETLFEEDESQQAAAAATAEMTQNKPPRPGIQPKLAGLPANPRAFKEGFSTDNFKRRSGSPKALAIPSNANPAY
KTSSTDSSATPYQVSQTSYSCSNPNILPAAPIKTTQAQPQNRSLSPGRQAPQSCPTLSSSTLPPGSEIVSRPRIV
RGNDIKRVQIRNSPRPPSEVVAPYCPDDLWLERGRGLAPPKSREPSGELPYPSDMHPGDVHYPDSPKRKAGAVSK
RVSPNSRNLTPSRRGDDLILRVDE*
Coding >Pro_DTO377G3_2|g2797.t1
ATGGCCCGGCGCGTATCGGAGACGCCTACTAGGCCCACCATCCTGATAGGGCGCTATACCATTACAACGATTCGT
CTCCTGAAGTGGGGATATTGGAGTCCCTCTTTCTGGAATTTCACTACCTTCACATATGCTACTCAATTCGCAGAC
ACATCTACCAACTATGGAATTTCCAAGGGCTACCACAGCATGCTCCTCCTTCCTATCCACAGGATACTCATCGCG
ATCCTCCTCTTATCCACACTCTGCTCTGCCGCCGAAAATGCCTCCAGCGATGCAGCAAACTCAGCTCTATATGAC
ATGGTCCCGGACTGTGCGAAGGATTGCGTCGATAGCTTCATCATGTCCGAATACACCTTCATTGAATGCACGTCA
CCGTCTAATATCAAGTGTCTGTGTCGTACCAAGACAACCAGTAGCTTGACATTGGGGGAAGCGGCTTTGAGCTGT
GTTCTGTCTGTATGCTCACAGACAGTCATCGCAAAGTCAAAGGCTTATCACATATGCGACTCGGTATCTGAAGCT
CTTCCGAAAACACACCAGACGATTACCGCGACGGTATTTTCTGACACAAGTACGACGAAGACGAGTGATGCAAAA
ACTAGTAGAGAGACAACACCAACTATTTCTACTTCGACAACTGAACACACCTCCGAGGCCTCTATGGGTACATCT
ATAGCAACATCAACATCGACACCGACGTCAACTACTAGTCAAACGTCTGAAATCACATTCTATGCTGCTTCTTCA
TCTTCAGGGTCTCAAGTTGAACCAACATCCTCTACCGGACAAATTTCCAGTGACTCTTCTGAAGATACGAATAAG
AAAGGTGACCATGGTATCACTCCAGCGGCGATCATTGGAATGTCAGTAGCATCAGGCGTGGCAGGGTTTTTCATC
ATCGGTGTTGCTGTATTTTTCTGCTGCAAGAGATGGCGACGAAAACAGCGGGAACAGACAGCACCACACATTTTC
GAGATCGGAGGCGCCATGTCTGAGCCTCCAGACTTTTCAAAACCCATGCCACGGCTCCCAACGAACGGCTTGGGT
TTAGAGTCTTCATACAGCCCAACGAGTGACCGCGAGACAATGGCACAGCGGCCACGTACTTTCCATTCAATGGCA
AGCGTTCAACCACCACGATACTCACCGCAATATGCCAAGGTCCACCACTTGGGCCAGAGCAAAGAGCCCACAGAC
CAAGAACGAATAGGGTTTGCCATCAGCTCTGACTCGGACTGGGAAACTTCGCCTCGGACACAATCGTCACAGCAC
AGCATAGCACGACTACTCCCAGATCCTATAGCTGGACTATACCCGAAGCCGCTGAAGTGGAGTCATCGGCCACCT
AGTGGGGAGACTCTATTTGAAGAGGACGAAAGTCAACAAGCAGCGGCGGCAGCGACAGCAGAAATGACGCAAAAC
AAGCCCCCTAGGCCAGGTATCCAACCAAAACTCGCAGGACTGCCAGCCAATCCGCGTGCATTCAAAGAGGGATTC
TCAACAGACAATTTCAAACGAAGATCCGGGTCCCCGAAAGCTTTAGCAATCCCTTCCAACGCCAACCCAGCTTAC
AAAACCTCGTCAACAGACAGTAGCGCTACACCCTATCAAGTTTCACAAACCTCATACTCTTGCTCAAACCCAAAC
ATTCTCCCTGCCGCTCCCATCAAGACCACGCAAGCTCAACCCCAGAATCGCAGCTTGTCACCAGGACGACAGGCG
CCTCAATCCTGCCCCACCCTATCATCATCAACCCTCCCTCCAGGCTCAGAGATAGTATCCAGGCCGCGGATCGTA
CGTGGAAACGATATCAAACGCGTCCAGATCCGCAACAGTCCACGACCACCCAGCGAAGTCGTCGCGCCATACTGC
CCAGATGACTTATGGCTGGAGCGTGGACGCGGCCTCGCGCCGCCGAAGTCCCGAGAACCGTCTGGGGAACTGCCG
TATCCTTCAGATATGCATCCTGGAGATGTGCATTATCCTGATAGTCCGAAAAGGAAGGCCGGCGCTGTGTCGAAA
CGGGTTTCTCCGAACAGTCGGAATTTGACGCCGTCGAGGAGGGGCGATGATTTGATTCTTCGCGTTGATGAATAG
Transcript >Pro_DTO377G3_2|g2797.t1
ATGGCCCGGCGCGTATCGGAGACGCCTACTAGGCCCACCATCCTGATAGGGCGCTATACCATTACAACGATTCGT
CTCCTGAAGTGGGGATATTGGAGTCCCTCTTTCTGGAATTTCACTACCTTCACATATGCTACTCAATTCGCAGAC
ACATCTACCAACTATGGAATTTCCAAGGGCTACCACAGCATGCTCCTCCTTCCTATCCACAGGATACTCATCGCG
ATCCTCCTCTTATCCACACTCTGCTCTGCCGCCGAAAATGCCTCCAGCGATGCAGCAAACTCAGCTCTATATGAC
ATGGTCCCGGACTGTGCGAAGGATTGCGTCGATAGCTTCATCATGTCCGAATACACCTTCATTGAATGCACGTCA
CCGTCTAATATCAAGTGTCTGTGTCGTACCAAGACAACCAGTAGCTTGACATTGGGGGAAGCGGCTTTGAGCTGT
GTTCTGTCTGTATGCTCACAGACAGTCATCGCAAAGTCAAAGGCTTATCACATATGCGACTCGGTATCTGAAGCT
CTTCCGAAAACACACCAGACGATTACCGCGACGGTATTTTCTGACACAAGTACGACGAAGACGAGTGATGCAAAA
ACTAGTAGAGAGACAACACCAACTATTTCTACTTCGACAACTGAACACACCTCCGAGGCCTCTATGGGTACATCT
ATAGCAACATCAACATCGACACCGACGTCAACTACTAGTCAAACGTCTGAAATCACATTCTATGCTGCTTCTTCA
TCTTCAGGGTCTCAAGTTGAACCAACATCCTCTACCGGACAAATTTCCAGTGACTCTTCTGAAGATACGAATAAG
AAAGGTGACCATGGTATCACTCCAGCGGCGATCATTGGAATGTCAGTAGCATCAGGCGTGGCAGGGTTTTTCATC
ATCGGTGTTGCTGTATTTTTCTGCTGCAAGAGATGGCGACGAAAACAGCGGGAACAGACAGCACCACACATTTTC
GAGATCGGAGGCGCCATGTCTGAGCCTCCAGACTTTTCAAAACCCATGCCACGGCTCCCAACGAACGGCTTGGGT
TTAGAGTCTTCATACAGCCCAACGAGTGACCGCGAGACAATGGCACAGCGGCCACGTACTTTCCATTCAATGGCA
AGCGTTCAACCACCACGATACTCACCGCAATATGCCAAGGTCCACCACTTGGGCCAGAGCAAAGAGCCCACAGAC
CAAGAACGAATAGGGTTTGCCATCAGCTCTGACTCGGACTGGGAAACTTCGCCTCGGACACAATCGTCACAGCAC
AGCATAGCACGACTACTCCCAGATCCTATAGCTGGACTATACCCGAAGCCGCTGAAGTGGAGTCATCGGCCACCT
AGTGGGGAGACTCTATTTGAAGAGGACGAAAGTCAACAAGCAGCGGCGGCAGCGACAGCAGAAATGACGCAAAAC
AAGCCCCCTAGGCCAGGTATCCAACCAAAACTCGCAGGACTGCCAGCCAATCCGCGTGCATTCAAAGAGGGATTC
TCAACAGACAATTTCAAACGAAGATCCGGGTCCCCGAAAGCTTTAGCAATCCCTTCCAACGCCAACCCAGCTTAC
AAAACCTCGTCAACAGACAGTAGCGCTACACCCTATCAAGTTTCACAAACCTCATACTCTTGCTCAAACCCAAAC
ATTCTCCCTGCCGCTCCCATCAAGACCACGCAAGCTCAACCCCAGAATCGCAGCTTGTCACCAGGACGACAGGCG
CCTCAATCCTGCCCCACCCTATCATCATCAACCCTCCCTCCAGGCTCAGAGATAGTATCCAGGCCGCGGATCGTA
CGTGGAAACGATATCAAACGCGTCCAGATCCGCAACAGTCCACGACCACCCAGCGAAGTCGTCGCGCCATACTGC
CCAGATGACTTATGGCTGGAGCGTGGACGCGGCCTCGCGCCGCCGAAGTCCCGAGAACCGTCTGGGGAACTGCCG
TATCCTTCAGATATGCATCCTGGAGATGTGCATTATCCTGATAGTCCGAAAAGGAAGGCCGGCGCTGTGTCGAAA
CGGGTTTCTCCGAACAGTCGGAATTTGACGCCGTCGAGGAGGGGCGATGATTTGATTCTTCGCGTTGATGAATAG
Gene >Pro_DTO377G3_2|g2797.t1
ATGGCCCGGCGCGTATCGGAGACGCCTACTAGGCCCACCATCCTGATAGGGCGCTATACCATTACAACGATTCGT
CTCCTGAAGTGGGGATGTGGGTGGGCGGGTCTTACCATCTCGAATCTTATGCGGTTTCACTCTAGCGCCTATACA
TACACAGCCTCAAGCACTGTGTTTCAGAATGATGTCGAAATGCAGATACTTGGACGCAACAGTCGATGGGCGTCA
TGGAAAGTTTTGCCTCGCGCCTCTGATGATGTCGCGCTCTGACTTGGTGTTTAACTAGATTGGAGTCCCTCTTTC
TGGAATTTCACTACCTTCACATATGCTACTCAATTCGCAGACACATCTACCAACTATGGTAACCGCATGTACAAG
CTTTCACGGGTAATCGTTCCCATGTAGGAATTTCCAAGGTCAGTTGATGGGAGAAATGTACATGACAGATCGTCG
CTCATGATAAACATGTATAGGGCTACCACAGCATGCTCCTCCTTCCTATCCACAGGATACTCATCGCGATCCTCC
TCTTATCCACACTCTGCTCTGCCGCCGAAAATGCCTCCAGCGATGCAGCAAACTCAGCTCTATATGACATGGTCC
CGGACTGTGCGAAGGATTGCGTCGATAGCTTCATCATGTCCGAATACACCTTCATTGAATGCACGTCACCGTCTA
ATATCAAGTGTCTGTGTCGTACCAAGACAACCAGTAGCTTGACATTGGGGGAAGCGGCTTTGAGCTGTGTTCTGT
CTGTATGCTCACAGACAGTCATCGCAAAGTCAAAGGCTTATCACATATGCGACTCGGTATCTGAAGCTCTTCCGA
AAACACACCAGACGATTACCGCGACGGTATTTTCTGACACAAGTACGACGAAGACGAGTGATGCAAAAACTAGTA
GAGAGACAACACCAACTATTTCTACTTCGACAACTGAACACACCTCCGAGGCCTCTATGGGTACATCTATAGCAA
CATCAACATCGACACCGACGTCAACTACTAGTCAAACGTCTGAAATCACATTCTATGCTGCTTCTTCATCTTCAG
GGTCTCAAGTTGAACCAACATCCTCTACCGGACAAATTTCCAGTGACTCTTCTGAAGATACGAATAAGAAAGGTG
ACCATGGTATCACTCCAGCGGCGATCATTGGAATGTCAGTAGCATCAGGCGTGGCAGGGTTTTTCATCATCGGTG
TTGCTGTATTTTTCTGCTGCAAGAGATGGCGACGAAAACAGCGGGAACAGACAGCACCACACATTTTCGAGATCG
GAGGCGCCATGTCTGAGCCTCCAGACTTTTCAAAACCCATGCCACGGCTCCCAACGAACGGCTTGGGTTTAGAGT
CTTCATACAGCCCAACGAGTGACCGCGAGACAATGGCACAGCGGCCACGTACTTTCCATTCAATGGCAAGCGTTC
AACCACCACGATACTCACCGCAATATGCCAAGGTCCACCACTTGGGCCAGAGCAAAGAGCCCACAGACCAAGAAC
GAATAGGGTTTGCCATCAGCTCTGACTCGGACTGGGAAACTTCGCCTCGGACACAATCGTCACAGCACAGCATAG
CACGACTACTCCCAGATCCTATAGCTGGACTATACCCGAAGCCGCTGAAGTGGAGTCATCGGCCACCTAGTGGGG
AGACTCTATTTGAAGAGGACGAAAGTCAACAAGCAGCGGCGGCAGCGACAGCAGAAATGACGCAAAACAAGCCCC
CTAGGCCAGGTATCCAACCAAAACTCGCAGGACTGCCAGCCAATCCGCGTGCATTCAAAGAGGGATTCTCAACAG
ACAATTTCAAACGAAGATCCGGGTCCCCGAAAGCTTTAGCAATCCCTTCCAACGCCAACCCAGCTTACAAAACCT
CGTCAACAGACAGTAGCGCTACACCCTATCAAGTTTCACAAACCTCATACTCTTGCTCAAACCCAAACATTCTCC
CTGCCGCTCCCATCAAGACCACGCAAGCTCAACCCCAGAATCGCAGCTTGTCACCAGGACGACAGGCGCCTCAAT
CCTGCCCCACCCTATCATCATCAACCCTCCCTCCAGGCTCAGAGATAGTATCCAGGCCGCGGATCGTACGTGGAA
ACGATATCAAACGCGTCCAGATCCGCAACAGTCCACGACCACCCAGCGAAGTCGTCGCGCCATACTGCCCAGATG
ACTTATGGCTGGAGCGTGGACGCGGCCTCGCGCCGCCGAAGTCCCGAGAACCGTCTGGGGAACTGCCGTATCCTT
CAGATATGCATCCTGGAGATGTGCATTATCCTGATAGTCCGAAAAGGAAGGCCGGCGCTGTGTCGAAACGGGTTT
CTCCGAACAGTCGGAATTTGACGCCGTCGAGGAGGGGCGATGATTTGATTCTTCGCGTTGATGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail