Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2780.t1
Gene name
Locationscaffold_03:932856..935491
Strand+
Gene length (bp)2635
Transcript length (bp)2580
Coding sequence length (bp)2580
Protein length (aa) 860

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 1.7E-35 732 857
PF04389 Peptidase_M28 Peptidase family M28 4.3E-19 487 670
PF02225 PA PA domain 3.1E-12 298 385

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 156 178 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2780.t1
MGDEKFDYQAVPIPSYAEATGQPSSSRSDLGDGTDVERQGLLGRDHAATRGYHPPTVESARSSLDDLESLASHSD
RESVEELRRELDQMDVDDSASASLTGRHTPLRHRFSKQLSSLGRTLSAIQRPFQRYMPTFRFTINLSDARARLKD
QGCIMLLRVFALLLVVTLVYVFFIADVFNINSRMAMGQSYSAASVENFIQGHINETNIADNLRRVTNYTHVAGTE
GSFALSKLIEQEFQNAGFDEVSREEFQVYLNYPRKDGRRVAIIDPPSLAWEAKLEEDNAKDLIFHGHSKSGNVTG
HLVYANFGSREDFELLANKGISLDGSIALVRYYGTESDRALKIKAAELAGAAGCIIYSDPAQDGFVKGPAFPEGR
YMPSDGVQRGGVSMMSQVIGDVLSPGWASTPGENHRLSPEDSPGLPKIPSLPLAWRDAQILLQGLKGHGSKVPKE
WVGGVPDVPEWWTGDQDSPIVHLMNLQDEIERQPIYNIHGIITGMDERDKKIIVGNHRDSWCMGSVDPGSGTATF
LEVVRAFGELLTYGWRPLRTIEFVSWDGEEYNLIGSTEHVEKEIDDLRANAFAYLNVDVGVAGPDFRVSASPVFE
RTVLQVLGRISDPYANATLKDIWDKKGSKITPLGAGSDYVAFQDIAGTSSIDFGFEGEPYPYHSCYETYDWMVNN
ADPDFQYHKILAQFWGLLLLDLSENPMLPFDLEVYGDSIVGWVKDLDKFAKSKNAEVDMQPMFRAATEMRANAVT
FQSWNKIWHDTVWGMGGYESNVMAVQRVNHNARMAAFDTNLLDLEEGGGIPNRTQFRHVIFGPELWSGYDPSIFP
AIRDSINTGNWTLTQYWIDRVANTIHHASDKLLH*
Coding >Pro_DTO377G3_2|g2780.t1
ATGGGCGACGAGAAGTTTGACTATCAGGCCGTCCCCATCCCTTCTTACGCCGAAGCTACCGGTCAACCCTCCTCA
TCTCGATCCGACCTTGGCGATGGAACAGATGTTGAACGACAGGGGCTACTCGGTCGCGATCATGCCGCAACCCGC
GGCTACCACCCACCAACCGTCGAATCGGCGCGCTCTAGCCTGGATGACCTGGAATCATTGGCCTCACACTCAGAC
CGAGAGTCGGTGGAAGAACTACGGCGGGAGCTAGACCAGATGGACGTGGATGATTCGGCATCGGCCTCCTTAACC
GGCAGACACACCCCTCTACGACATCGTTTTTCCAAGCAGCTATCGAGTCTGGGTCGTACCCTGTCCGCTATACAA
CGACCCTTCCAACGATATATGCCTACTTTCCGCTTCACGATCAACCTTAGTGACGCTAGGGCACGCTTAAAAGAT
CAGGGGTGCATCATGCTTCTCCGAGTATTCGCTCTTTTACTGGTGGTCACCTTAGTGTATGTGTTCTTCATCGCA
GATGTCTTCAATATCAACAGTCGCATGGCCATGGGTCAGTCCTATAGCGCCGCCTCCGTCGAGAACTTCATTCAA
GGCCACATCAACGAGACCAATATCGCCGATAATTTGCGACGAGTCACAAACTACACCCACGTAGCTGGCACGGAA
GGCAGCTTTGCGCTATCAAAATTGATTGAACAAGAGTTCCAGAATGCAGGGTTTGATGAAGTGTCGCGGGAGGAA
TTCCAGGTCTACCTCAACTACCCACGCAAGGATGGGAGGAGAGTCGCCATCATCGATCCACCTAGTCTAGCTTGG
GAGGCGAAACTCGAAGAGGACAACGCCAAGGACCTGATCTTCCATGGCCATTCGAAATCCGGCAATGTCACTGGG
CATCTGGTGTATGCTAACTTCGGATCCCGGGAAGATTTCGAGCTGCTCGCAAATAAAGGAATTTCACTCGATGGC
TCAATTGCCTTGGTCCGATACTATGGTACTGAATCAGATCGCGCATTGAAAATCAAGGCTGCTGAATTAGCCGGG
GCTGCCGGCTGTATCATCTACTCCGATCCCGCTCAGGACGGATTTGTCAAAGGCCCGGCCTTCCCCGAAGGGCGA
TACATGCCAAGCGATGGCGTGCAAAGGGGCGGTGTCAGTATGATGTCGCAGGTAATTGGCGATGTTCTCAGCCCT
GGATGGGCATCTACGCCGGGAGAAAACCATCGTCTGTCCCCCGAGGACAGCCCCGGTCTACCCAAGATTCCCAGT
CTCCCACTTGCTTGGCGCGATGCACAGATACTTTTGCAGGGCCTCAAAGGCCATGGCTCCAAAGTACCAAAGGAA
TGGGTGGGCGGTGTTCCTGACGTACCAGAGTGGTGGACAGGTGACCAGGACTCCCCGATCGTTCATCTGATGAAC
CTGCAAGATGAAATAGAGCGGCAACCTATCTACAACATCCACGGCATAATAACCGGAATGGACGAGCGTGACAAG
AAGATCATTGTTGGCAACCACCGAGATTCGTGGTGCATGGGAAGTGTTGACCCTGGAAGTGGCACTGCTACTTTC
CTAGAGGTTGTACGAGCCTTCGGCGAGTTGCTCACCTACGGATGGCGACCACTTCGCACCATTGAATTTGTCAGT
TGGGACGGAGAGGAGTACAATTTGATCGGCTCAACCGAACATGTCGAGAAGGAGATCGATGATCTCCGTGCAAAT
GCCTTTGCCTACCTGAATGTCGACGTGGGCGTTGCGGGCCCCGATTTCCGTGTGTCTGCGTCGCCTGTTTTTGAG
CGCACCGTGCTACAGGTTCTGGGTCGTATCTCTGACCCCTATGCGAACGCAACACTGAAAGACATTTGGGATAAA
AAGGGCTCAAAGATTACTCCACTTGGCGCTGGAAGTGATTATGTTGCGTTCCAGGATATCGCTGGCACTTCGAGC
ATTGACTTCGGATTTGAGGGCGAGCCCTATCCATACCACAGCTGCTACGAAACATATGACTGGATGGTTAATAAC
GCAGACCCCGATTTCCAATACCACAAAATCCTGGCTCAATTCTGGGGGCTTCTCCTTCTAGACCTTTCGGAGAAT
CCCATGCTGCCATTTGACCTAGAAGTCTACGGCGACTCCATTGTCGGATGGGTCAAAGACTTGGACAAATTTGCC
AAATCAAAGAACGCCGAGGTAGACATGCAGCCCATGTTCAGGGCTGCGACCGAGATGAGAGCCAATGCTGTTACA
TTCCAGTCCTGGAACAAAATCTGGCACGATACTGTATGGGGCATGGGTGGTTATGAAAGCAATGTTATGGCAGTC
CAGCGGGTGAACCATAATGCTCGAATGGCTGCTTTTGATACCAATCTACTTGACTTGGAAGAAGGCGGAGGTATC
CCCAACCGCACACAATTCCGACACGTTATCTTTGGGCCAGAGCTGTGGTCCGGCTACGATCCCTCGATCTTCCCT
GCTATCCGCGACAGCATCAACACGGGGAATTGGACATTGACCCAATATTGGATCGACCGGGTCGCTAACACCATC
CACCACGCCAGCGACAAGCTGCTCCATTAA
Transcript >Pro_DTO377G3_2|g2780.t1
ATGGGCGACGAGAAGTTTGACTATCAGGCCGTCCCCATCCCTTCTTACGCCGAAGCTACCGGTCAACCCTCCTCA
TCTCGATCCGACCTTGGCGATGGAACAGATGTTGAACGACAGGGGCTACTCGGTCGCGATCATGCCGCAACCCGC
GGCTACCACCCACCAACCGTCGAATCGGCGCGCTCTAGCCTGGATGACCTGGAATCATTGGCCTCACACTCAGAC
CGAGAGTCGGTGGAAGAACTACGGCGGGAGCTAGACCAGATGGACGTGGATGATTCGGCATCGGCCTCCTTAACC
GGCAGACACACCCCTCTACGACATCGTTTTTCCAAGCAGCTATCGAGTCTGGGTCGTACCCTGTCCGCTATACAA
CGACCCTTCCAACGATATATGCCTACTTTCCGCTTCACGATCAACCTTAGTGACGCTAGGGCACGCTTAAAAGAT
CAGGGGTGCATCATGCTTCTCCGAGTATTCGCTCTTTTACTGGTGGTCACCTTAGTGTATGTGTTCTTCATCGCA
GATGTCTTCAATATCAACAGTCGCATGGCCATGGGTCAGTCCTATAGCGCCGCCTCCGTCGAGAACTTCATTCAA
GGCCACATCAACGAGACCAATATCGCCGATAATTTGCGACGAGTCACAAACTACACCCACGTAGCTGGCACGGAA
GGCAGCTTTGCGCTATCAAAATTGATTGAACAAGAGTTCCAGAATGCAGGGTTTGATGAAGTGTCGCGGGAGGAA
TTCCAGGTCTACCTCAACTACCCACGCAAGGATGGGAGGAGAGTCGCCATCATCGATCCACCTAGTCTAGCTTGG
GAGGCGAAACTCGAAGAGGACAACGCCAAGGACCTGATCTTCCATGGCCATTCGAAATCCGGCAATGTCACTGGG
CATCTGGTGTATGCTAACTTCGGATCCCGGGAAGATTTCGAGCTGCTCGCAAATAAAGGAATTTCACTCGATGGC
TCAATTGCCTTGGTCCGATACTATGGTACTGAATCAGATCGCGCATTGAAAATCAAGGCTGCTGAATTAGCCGGG
GCTGCCGGCTGTATCATCTACTCCGATCCCGCTCAGGACGGATTTGTCAAAGGCCCGGCCTTCCCCGAAGGGCGA
TACATGCCAAGCGATGGCGTGCAAAGGGGCGGTGTCAGTATGATGTCGCAGGTAATTGGCGATGTTCTCAGCCCT
GGATGGGCATCTACGCCGGGAGAAAACCATCGTCTGTCCCCCGAGGACAGCCCCGGTCTACCCAAGATTCCCAGT
CTCCCACTTGCTTGGCGCGATGCACAGATACTTTTGCAGGGCCTCAAAGGCCATGGCTCCAAAGTACCAAAGGAA
TGGGTGGGCGGTGTTCCTGACGTACCAGAGTGGTGGACAGGTGACCAGGACTCCCCGATCGTTCATCTGATGAAC
CTGCAAGATGAAATAGAGCGGCAACCTATCTACAACATCCACGGCATAATAACCGGAATGGACGAGCGTGACAAG
AAGATCATTGTTGGCAACCACCGAGATTCGTGGTGCATGGGAAGTGTTGACCCTGGAAGTGGCACTGCTACTTTC
CTAGAGGTTGTACGAGCCTTCGGCGAGTTGCTCACCTACGGATGGCGACCACTTCGCACCATTGAATTTGTCAGT
TGGGACGGAGAGGAGTACAATTTGATCGGCTCAACCGAACATGTCGAGAAGGAGATCGATGATCTCCGTGCAAAT
GCCTTTGCCTACCTGAATGTCGACGTGGGCGTTGCGGGCCCCGATTTCCGTGTGTCTGCGTCGCCTGTTTTTGAG
CGCACCGTGCTACAGGTTCTGGGTCGTATCTCTGACCCCTATGCGAACGCAACACTGAAAGACATTTGGGATAAA
AAGGGCTCAAAGATTACTCCACTTGGCGCTGGAAGTGATTATGTTGCGTTCCAGGATATCGCTGGCACTTCGAGC
ATTGACTTCGGATTTGAGGGCGAGCCCTATCCATACCACAGCTGCTACGAAACATATGACTGGATGGTTAATAAC
GCAGACCCCGATTTCCAATACCACAAAATCCTGGCTCAATTCTGGGGGCTTCTCCTTCTAGACCTTTCGGAGAAT
CCCATGCTGCCATTTGACCTAGAAGTCTACGGCGACTCCATTGTCGGATGGGTCAAAGACTTGGACAAATTTGCC
AAATCAAAGAACGCCGAGGTAGACATGCAGCCCATGTTCAGGGCTGCGACCGAGATGAGAGCCAATGCTGTTACA
TTCCAGTCCTGGAACAAAATCTGGCACGATACTGTATGGGGCATGGGTGGTTATGAAAGCAATGTTATGGCAGTC
CAGCGGGTGAACCATAATGCTCGAATGGCTGCTTTTGATACCAATCTACTTGACTTGGAAGAAGGCGGAGGTATC
CCCAACCGCACACAATTCCGACACGTTATCTTTGGGCCAGAGCTGTGGTCCGGCTACGATCCCTCGATCTTCCCT
GCTATCCGCGACAGCATCAACACGGGGAATTGGACATTGACCCAATATTGGATCGACCGGGTCGCTAACACCATC
CACCACGCCAGCGACAAGCTGCTCCATTAA
Gene >Pro_DTO377G3_2|g2780.t1
ATGGGCGACGAGAAGTTTGACTATCAGGCCGTCCCCATCCCTTCTTACGCCGAAGCTACCGGTCAACCCTCCTCA
TCTCGATCCGACCTTGGCGATGGAACAGATGTTGAACGACAGGGGCTACTCGGTCGCGATCATGCCGCAACCCGC
GGCTACCACCCACCAACCGTCGAATCGGCGCGCTCTAGCCTGGATGACCTGGAATCATTGGCCTCACACTCAGAC
CGAGAGTCGGTGGAAGAACTACGGCGGGAGCTAGACCAGATGGACGTGGATGATTCGGCATCGGCCTCCTTAACC
GGCAGACACACCCCTCTACGACATCGTTTTTCCAAGCAGCTATCGAGTCTGGGTCGTACCCTGTCCGCTATACAA
CGACCCTTCCAACGATATATGCCTACTTTCCGCTTCACGATCAACCTTAGTGACGCTAGGGCACGCTTAAAAGAT
CAGGGGTGCATCATGCTTCTCCGAGTATTCGCTCTTTTACTGGTGGTCACCTTAGTGTATGTGTTCTTCATCGCA
GATGTCTTCAATATCAACAGTCGCATGGCCATGGGTCAGTCCTATAGCGCCGCCTCCGTCGAGAACTTCATTCAA
GGCCACATCAACGAGACCAATATCGCCGATAATTTGCGACGAGTCACAAACTACACCCACGTAGCTGGCACGGAA
GGCAGCTTTGCGCTATCAAAATTGATTGAACAAGAGTTCCAGAATGCAGGGTTTGATGAAGTGTCGCGGGAGGAA
TTCCAGGTCTACCTCAACTACCCACGCAAGGATGGGAGGAGAGTCGCCATCATCGATCCACCTAGTCTAGCTTGG
GAGGCGAAACTCGAAGAGGACAACGCCAAGGACCTGATCTTCCATGGCCATTCGAAATCCGGCAATGTCACTGGG
CATCTGGTGTATGCTAACTTCGGATCCCGGGAAGATTTCGAGCTGCTCGCAAATAAAGGAATTTCACTCGATGGC
TCAATTGCCTTGGTCCGATACTATGGTACTGAATCAGATCGCGCATTGAAAATCAAGGCTGCTGAATTAGCCGGG
GCTGCCGGCTGTATCATCTACTCCGATCCCGCTCAGGACGGATTTGTCAAAGGCCCGGCCTTCCCCGAAGGGCGA
TACATGCCAAGCGATGGCGTGCAAAGGGGCGGTGTCAGTATGATGTCGCAGGTAATTGGCGATGTTCTCAGCCCT
GGATGGGCATCTACGCCGGGAGAAAACCATCGTCTGTCCCCCGAGGACAGCCCCGGTCTACCCAAGATTCCCAGT
CTCCCACTTGCTTGGCGCGATGCACAGATACTTTTGCAGGGCCTCAAAGGCCATGGCTCCAAAGTACCAAAGGAA
TGGGTGGGCGGTGTTCCTGACGTACCAGAGTGGTGGACAGGTGACCAGGACTCCCCGATCGTTCATCTGATGAAC
CTGCAAGATGAAATAGAGCGGCAACCTATCTACAACATCCACGGCATAATAACCGGAATGGACGAGCGTGACAAG
AAGATCATTGTTGGCAACCACCGAGATTCGTGGTGCATGGGAAGTGTTGACCCTGGAAGTGGCACTGCTACTTTC
CTAGAGGTTGTACGAGCCTTCGGCGAGTTGCTCACCTACGGATGGCGACCACTTCGCACCATTGAATTTGTCAGT
TGGGACGGAGAGGAGTACAATTTGATCGGCTCAACCGAACATGTCGAGAAGGAGATCGATGATCTCCGTGCAAAT
GCCTTTGCCTACCTGAATGTCGACGTGGGCGTTGCGGGCCCCGATTTCCGTGTGTCTGCGTCGCCTGTTTTTGAG
CGCACCGTGCTACAGGTTCTGGGTCGTATCTCTGACCCCTATGCGAACGCAACACTGAAAGACATTTGGGATAAA
AAGGGCTCAAAGATTACTCCACTTGGCGCTGGAAGTGATTATGTTGCGTTCCAGGATATCGCTGGCACTTCGAGC
ATTGACTTCGGATTTGAGGGCGAGCCCTATCCATACCACAGCTGCTACGAAACATATGACTGGATGGTTAATAAC
GCAGACCCCGATTTCCAATACCACAAAATCCTGGCTCAATTCTGGGGGCTTCTCCTTCTAGACCTTTCGGAGAAT
CCCATGCTGCCATTTGACCTAGAAGTCTACGGCGACTCCATTGTCGGATGGGTCAAAGACTTGGACAAATTTGCC
AAATCAAAGAACGCCGAGGTAGACATGCAGCCCATGTTCAGGGCTGCGACCGAGATGAGAGCCAATGCTGTTACA
TTCCAGTCCTGGAACAAAATCTGGCACGATACTGTATGGGGCATGGGTGGTTATGAAAGCAATGTTATGGCAGTC
CAGCGGGTGAACCATAATGCTCGAATGGCTGCTTTTGATACCAATCTACTTGACTTGGAAGAAGGCGGAGGTGTA
AGTTGACGTTCTGCTTGATTCATTCCTCGGCCCTAACTGATGATTTGTACAGATCCCCAACCGCACACAATTCCG
ACACGTTATCTTTGGGCCAGAGCTGTGGTCCGGCTACGATCCCTCGATCTTCCCTGCTATCCGCGACAGCATCAA
CACGGGGAATTGGACATTGACCCAATATTGGATCGACCGGGTCGCTAACACCATCCACCACGCCAGCGACAAGCT
GCTCCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail