Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2769.t1
Gene name
Locationscaffold_03:904679..907402
Strand+
Gene length (bp)2723
Transcript length (bp)2559
Coding sequence length (bp)2559
Protein length (aa) 853

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 5.5E-86 6 329
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.7E-10 574 646
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 4.2E-05 779 841
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 1.3E-07 578 675
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 8.7E-07 565 636

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016410 N-acyltransferase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016407 acetyltransferase activity No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 35.62 21.66 49.58
5d_25C Five days - 25 degrees Celsius 30.82 18.65 42.99
7d_25C Seven days - 25 degrees Celsius 26.82 16.02 37.62
10d_25C Ten days - 25 degrees Celsius 27.08 16.14 38.02
7d_15C Seven days - 15 degrees Celsius 35.58 21.29 49.87
7d_30C Seven days - 30 degrees Celsius 26.75 15.78 37.72

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.579339 no
3d_25C 7d_25C 0.220632 no
3d_25C 7d_15C 0.997259 no
3d_25C 7d_30C 0.222787 no
3d_25C 10d_25C 0.239111 no
5d_25C 7d_25C 0.606521 no
5d_25C 7d_15C 0.590428 no
5d_25C 7d_30C 0.608432 no
5d_25C 10d_25C 0.639264 no
7d_25C 7d_15C 0.222685 no
7d_25C 7d_30C 0.994134 no
7d_25C 10d_25C 0.979739 no
7d_15C 7d_30C 0.229627 no
7d_15C 10d_25C 0.245118 no
7d_30C 10d_25C 0.973834 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2769.t1
MVSSDLKKQVGQLFAVGFYGCTPSPEIKILIHDYHVGGIVLFSRNFENSEQLQALTLALQNEARLAGHERPLLIG
IDQENGLVTRISPPIAAQVPGAMALGATHDPECAYSAGKATGETLSFFGINMNYAPVCDINSEPLNPVVGVRSFG
DDPEFVGRFASAAARGLREQNIVPSVKHFPGHGDTAVDSHYGLPVIPKTRDQLERCELIPFRRAVAEGIETVMTA
HISLPCIDLTRPATLSPDVMGILRKDMAYDGMIITDCLEMDGIRSTYGTEEGSVLALRAGSDSIMICHTFDVQVA
SIKAVCEAIKSGRIEQSRLADACRHVATVKDKYLNWDVALQKSNLADLNSLNNRIAETTMDIYSRSTTLVRDKNG
ILPLSKTSIIIFLFPGDNIPVGGAVDGEGTGRPGLYQSNRYLDVLRQHNNSIAELRYGATGLTSEQWRTLEVADV
VIFTSFNARESPYQESLGLELAERVHALVHIAVCNPYDFLDAPSVKTYITTYEPTIEAFSVAADIMFGALVPTGA
LPLGINASTKTSAVVMPFDAQRDLDEVVEVWAAALPTYLIPAESLRSLIVRPHGHHFIARFGSQLVGFCLAYTNA
HSAPNTVYIAVLAVSPKYQHQGIGIALLDETRAYFRATFGFNNVKLGSSFPRFWPGIPQDLPETVQHFFTHRGFR
LSPPSARSVDLYQDIRNFQSPEKYITRARERGFRFAPLKPEDYEACLVGQRKNFSKDSSWVEAYVALHPDKYPDS
VMIAFDSHGQQVGWTLMLGPSYALNKSWAFPQTCGPNTGLIGAVGIDESHRKHGIGLALICHAIENMKQRGIEGV
FVDWVALDGWYEQVGFKTWRSYRPGEL*
Coding >Pro_DTO377G3_2|g2769.t1
ATGGTTTCTTCAGATCTTAAAAAGCAGGTTGGCCAGCTCTTCGCGGTGGGGTTCTATGGCTGCACCCCAAGTCCC
GAAATCAAGATTTTGATTCATGACTACCACGTTGGAGGTATCGTTCTCTTCTCGCGCAATTTTGAGAATTCAGAA
CAGCTCCAGGCCTTGACACTAGCTTTACAGAATGAAGCCAGATTGGCTGGACATGAGCGACCATTATTGATCGGA
ATCGATCAGGAGAATGGGTTGGTCACTCGCATATCTCCGCCAATCGCTGCTCAAGTACCAGGCGCCATGGCACTC
GGCGCCACGCATGACCCGGAGTGCGCCTACAGTGCGGGGAAAGCCACGGGGGAAACTTTGAGTTTCTTCGGGATT
AACATGAACTATGCACCGGTGTGCGATATCAACTCGGAGCCCTTAAACCCAGTTGTTGGTGTACGCAGCTTTGGT
GATGACCCTGAATTTGTGGGCCGGTTTGCGAGTGCGGCCGCGCGGGGTTTGCGGGAGCAAAACATCGTCCCTAGT
GTGAAGCATTTTCCAGGTCATGGAGACACAGCTGTGGACTCGCATTATGGACTACCGGTGATTCCCAAAACAAGG
GATCAGCTGGAGCGTTGCGAATTGATTCCATTTAGGCGGGCTGTCGCTGAAGGCATCGAGACCGTCATGACTGCT
CATATCTCGCTGCCCTGTATCGATCTCACGCGGCCTGCAACACTTTCTCCGGATGTTATGGGGATTTTGCGCAAG
GACATGGCCTATGATGGTATGATCATCACAGACTGCCTGGAGATGGATGGAATCCGCTCTACATACGGTACAGAA
GAAGGCTCGGTCCTAGCGTTGCGCGCTGGCAGCGATAGCATCATGATCTGTCATACCTTTGATGTGCAGGTAGCA
TCGATCAAGGCAGTTTGTGAAGCAATAAAGTCCGGCAGAATCGAGCAGTCACGACTGGCGGACGCTTGTCGCCAT
GTTGCTACGGTGAAGGACAAGTATTTGAACTGGGATGTCGCTCTTCAAAAATCTAATCTCGCAGACTTGAACTCG
CTCAACAATAGAATTGCCGAGACGACTATGGATATATATTCTCGATCGACCACACTCGTTCGTGACAAAAATGGC
ATTCTCCCCCTATCAAAGACTTCAATCATCATCTTCCTCTTCCCTGGAGATAATATCCCAGTCGGTGGTGCGGTT
GACGGCGAAGGAACGGGGAGGCCAGGATTATATCAGTCTAACAGATATCTTGATGTCTTGCGGCAACACAACAAT
TCCATTGCGGAGCTCAGATACGGAGCGACCGGTTTGACTTCGGAGCAATGGCGAACCCTTGAAGTCGCTGATGTG
GTGATTTTCACTTCATTCAATGCAAGAGAGTCGCCATACCAGGAGTCATTAGGCTTGGAACTCGCTGAACGTGTT
CATGCATTGGTGCATATTGCTGTTTGCAACCCTTACGACTTCCTTGATGCTCCTAGTGTGAAGACCTATATTACC
ACATACGAGCCGACCATCGAGGCATTTTCTGTGGCTGCCGATATCATGTTTGGAGCATTAGTCCCGACAGGTGCT
CTTCCGCTGGGGATTAATGCTTCGACAAAGACCTCTGCGGTAGTAATGCCATTTGATGCGCAAAGAGATCTGGAT
GAGGTGGTCGAAGTCTGGGCCGCTGCTCTCCCGACCTACCTTATTCCCGCTGAAAGTTTGCGGTCTCTGATAGTA
CGCCCGCATGGTCACCATTTCATCGCGCGTTTTGGATCGCAGCTAGTAGGCTTCTGTCTTGCTTATACAAATGCC
CATAGTGCACCAAACACCGTGTATATCGCAGTTCTTGCCGTGTCGCCAAAGTACCAACATCAAGGCATTGGAATT
GCCTTGCTAGACGAAACAAGAGCATACTTCCGGGCAACCTTTGGCTTCAATAATGTGAAGCTGGGCAGCTCATTC
CCCCGCTTTTGGCCCGGGATACCCCAGGACCTTCCAGAAACAGTGCAACATTTCTTCACTCACCGTGGTTTCCGA
CTCAGCCCTCCCAGTGCCCGGTCGGTTGATTTGTACCAAGATATTCGGAACTTCCAGTCGCCAGAGAAGTATATC
ACTCGTGCCCGGGAGCGAGGCTTCCGCTTCGCGCCATTAAAACCCGAAGATTACGAGGCCTGTTTGGTTGGCCAA
AGAAAAAACTTCTCTAAGGACAGTAGCTGGGTGGAGGCATACGTCGCTTTACATCCCGACAAGTATCCCGACAGT
GTGATGATAGCATTCGACTCTCACGGCCAGCAGGTTGGTTGGACACTAATGCTCGGTCCATCATATGCTTTGAAC
AAGTCTTGGGCATTCCCCCAAACCTGTGGTCCAAACACAGGGCTCATTGGTGCCGTAGGAATTGATGAATCACAC
CGCAAGCATGGCATTGGACTGGCATTGATCTGTCATGCTATTGAAAACATGAAGCAGCGAGGCATTGAAGGTGTC
TTTGTAGACTGGGTTGCGCTCGACGGGTGGTATGAGCAGGTTGGGTTCAAGACCTGGAGAAGCTACAGGCCCGGG
GAGCTTTGA
Transcript >Pro_DTO377G3_2|g2769.t1
ATGGTTTCTTCAGATCTTAAAAAGCAGGTTGGCCAGCTCTTCGCGGTGGGGTTCTATGGCTGCACCCCAAGTCCC
GAAATCAAGATTTTGATTCATGACTACCACGTTGGAGGTATCGTTCTCTTCTCGCGCAATTTTGAGAATTCAGAA
CAGCTCCAGGCCTTGACACTAGCTTTACAGAATGAAGCCAGATTGGCTGGACATGAGCGACCATTATTGATCGGA
ATCGATCAGGAGAATGGGTTGGTCACTCGCATATCTCCGCCAATCGCTGCTCAAGTACCAGGCGCCATGGCACTC
GGCGCCACGCATGACCCGGAGTGCGCCTACAGTGCGGGGAAAGCCACGGGGGAAACTTTGAGTTTCTTCGGGATT
AACATGAACTATGCACCGGTGTGCGATATCAACTCGGAGCCCTTAAACCCAGTTGTTGGTGTACGCAGCTTTGGT
GATGACCCTGAATTTGTGGGCCGGTTTGCGAGTGCGGCCGCGCGGGGTTTGCGGGAGCAAAACATCGTCCCTAGT
GTGAAGCATTTTCCAGGTCATGGAGACACAGCTGTGGACTCGCATTATGGACTACCGGTGATTCCCAAAACAAGG
GATCAGCTGGAGCGTTGCGAATTGATTCCATTTAGGCGGGCTGTCGCTGAAGGCATCGAGACCGTCATGACTGCT
CATATCTCGCTGCCCTGTATCGATCTCACGCGGCCTGCAACACTTTCTCCGGATGTTATGGGGATTTTGCGCAAG
GACATGGCCTATGATGGTATGATCATCACAGACTGCCTGGAGATGGATGGAATCCGCTCTACATACGGTACAGAA
GAAGGCTCGGTCCTAGCGTTGCGCGCTGGCAGCGATAGCATCATGATCTGTCATACCTTTGATGTGCAGGTAGCA
TCGATCAAGGCAGTTTGTGAAGCAATAAAGTCCGGCAGAATCGAGCAGTCACGACTGGCGGACGCTTGTCGCCAT
GTTGCTACGGTGAAGGACAAGTATTTGAACTGGGATGTCGCTCTTCAAAAATCTAATCTCGCAGACTTGAACTCG
CTCAACAATAGAATTGCCGAGACGACTATGGATATATATTCTCGATCGACCACACTCGTTCGTGACAAAAATGGC
ATTCTCCCCCTATCAAAGACTTCAATCATCATCTTCCTCTTCCCTGGAGATAATATCCCAGTCGGTGGTGCGGTT
GACGGCGAAGGAACGGGGAGGCCAGGATTATATCAGTCTAACAGATATCTTGATGTCTTGCGGCAACACAACAAT
TCCATTGCGGAGCTCAGATACGGAGCGACCGGTTTGACTTCGGAGCAATGGCGAACCCTTGAAGTCGCTGATGTG
GTGATTTTCACTTCATTCAATGCAAGAGAGTCGCCATACCAGGAGTCATTAGGCTTGGAACTCGCTGAACGTGTT
CATGCATTGGTGCATATTGCTGTTTGCAACCCTTACGACTTCCTTGATGCTCCTAGTGTGAAGACCTATATTACC
ACATACGAGCCGACCATCGAGGCATTTTCTGTGGCTGCCGATATCATGTTTGGAGCATTAGTCCCGACAGGTGCT
CTTCCGCTGGGGATTAATGCTTCGACAAAGACCTCTGCGGTAGTAATGCCATTTGATGCGCAAAGAGATCTGGAT
GAGGTGGTCGAAGTCTGGGCCGCTGCTCTCCCGACCTACCTTATTCCCGCTGAAAGTTTGCGGTCTCTGATAGTA
CGCCCGCATGGTCACCATTTCATCGCGCGTTTTGGATCGCAGCTAGTAGGCTTCTGTCTTGCTTATACAAATGCC
CATAGTGCACCAAACACCGTGTATATCGCAGTTCTTGCCGTGTCGCCAAAGTACCAACATCAAGGCATTGGAATT
GCCTTGCTAGACGAAACAAGAGCATACTTCCGGGCAACCTTTGGCTTCAATAATGTGAAGCTGGGCAGCTCATTC
CCCCGCTTTTGGCCCGGGATACCCCAGGACCTTCCAGAAACAGTGCAACATTTCTTCACTCACCGTGGTTTCCGA
CTCAGCCCTCCCAGTGCCCGGTCGGTTGATTTGTACCAAGATATTCGGAACTTCCAGTCGCCAGAGAAGTATATC
ACTCGTGCCCGGGAGCGAGGCTTCCGCTTCGCGCCATTAAAACCCGAAGATTACGAGGCCTGTTTGGTTGGCCAA
AGAAAAAACTTCTCTAAGGACAGTAGCTGGGTGGAGGCATACGTCGCTTTACATCCCGACAAGTATCCCGACAGT
GTGATGATAGCATTCGACTCTCACGGCCAGCAGGTTGGTTGGACACTAATGCTCGGTCCATCATATGCTTTGAAC
AAGTCTTGGGCATTCCCCCAAACCTGTGGTCCAAACACAGGGCTCATTGGTGCCGTAGGAATTGATGAATCACAC
CGCAAGCATGGCATTGGACTGGCATTGATCTGTCATGCTATTGAAAACATGAAGCAGCGAGGCATTGAAGGTGTC
TTTGTAGACTGGGTTGCGCTCGACGGGTGGTATGAGCAGGTTGGGTTCAAGACCTGGAGAAGCTACAGGCCCGGG
GAGCTTTGA
Gene >Pro_DTO377G3_2|g2769.t1
ATGGTTTCTTCAGATCTTAAAAAGCAGGTTGGCCAGGTATATGAGCTCTGAAACCCCTGTTTTGTGAATCTCACT
GACGATCGCAGCTCTTCGCGGTGGGGTTCTATGGCTGCACCCCAAGTCCCGAAATCAAGATTTTGATTCATGACT
ACCACGTTGGAGGTATCGTTCTCTTCTCGCGCAATTTTGAGAATTCAGAACAGCTCCAGGTGCGATATCCGAGGT
TCCAAGTATCTTGACGCGTGACTAATCTTCTTCAGGCCTTGACACTAGCTTTACAGAATGAAGCCAGATTGGCTG
GACATGAGCGACCATTATTGATCGGAATCGATCAGGAGAATGGGTTGGTCACTCGCATATCTCCGCCAATCGCTG
CTCAAGTACCAGGCGCCATGGCACTCGGCGCCACGCATGACCCGGAGTGCGCCTACAGTGCGGGGAAAGCCACGG
GGGAAACTTTGAGTTTCTTCGGGATTAACATGAACTATGCACCGGTGTGCGATATCAACTCGGAGCCCTTAAACC
CAGTTGTTGGTGTACGCAGCTTTGGTGATGACCCTGAATTTGTGGGCCGGTTTGCGAGTGCGGCCGCGCGGGGTT
TGCGGGAGCAAAACATCGTCCCTAGTGTGAAGCATTTTCCAGGTCATGGAGACACAGCTGTGGACTCGCATTATG
GACTACCGGTGATTCCCAAAACAAGGGATCAGCTGGAGCGTTGCGAATTGATTCCATTTAGGCGGGCTGTCGCTG
AAGGCATCGAGACCGTCATGACTGCTCATATCTCGCTGCCCTGTATCGATCTCACGCGGCCTGCAACACTTTCTC
CGGATGTTATGGGGATTTTGCGCAAGGACATGGCCTATGATGGTATGATCATCACAGACTGCCTGGAGATGGATG
GAATCCGCTCTACATACGGTACAGAAGAAGGCTCGGTCCTAGCGTTGCGCGCTGGCAGCGATAGCATCATGATCT
GTCATACCTTTGATGTGCAGGTAGCATCGATCAAGGCAGTTTGTGAAGCAATAAAGTCCGGCAGAATCGAGCAGT
CACGACTGGCGGACGCTTGTCGCCATGTTGCTACGGTGAAGGACAAGTATTTGAACTGGGATGTCGCTCTTCAAA
AATCTAATCTCGCAGACTTGAACTCGCTCAACAATAGAATTGCCGAGACGACTATGGATATATATTCTCGATCGA
CCACACTCGTTCGTGACAAAAATGGCATTCTCCCCCTATCAAAGACTTCAATCATCATCTTCCTCTTCCCTGGAG
ATAATATCCCAGTCGGTGGTGCGGTTGACGGCGAAGGAACGGGGAGGCCAGGATTATATCAGTCTAACAGATATC
TTGATGTCTTGCGGCAACACAACAATTCCATTGCGGAGCTCAGATACGGAGCGACCGGTTTGACTTCGGAGCAAT
GGCGAACCCTTGAAGTCGCTGATGTGGTGATTTTCACTTCATTCAATGCAAGAGAGTCGCCATACCAGGAGTCAT
TAGGCTTGGAACTCGCTGAACGTGTTCATGCATTGGTGCATATTGCTGTTTGCAACCCTTACGACTTCCTTGATG
CTCCTAGTGTGAAGACCTATATTACCACATACGAGCCGACCATCGAGGCATTTTCTGTGGCTGCCGATATCATGT
TTGGAGCATTAGTCCCGACAGGTGCTCTTCCGCTGGGGATTAATGCTTCGACAAAGACCTCTGCGGTAGTAATGC
CATTTGATGCGCAAAGAGATCTGGATGAGGTGGTCGAAGTCTGGGCCGCTGCTCTCCCGACCTACCTTATTCCCG
CTGAAAGTTTGCGGTCTCTGATAGTACGCCCGCATGGTCACCATTTCATCGCGCGTTTTGGATCGCAGCTAGTAG
GCTTCTGTCTTGCTTATACAAATGCCCATAGTGCACCAAACACCGTGTATATCGCAGTTCTTGCCGTGTCGCCAA
AGTACCAACATCAAGGCATTGGAATTGCCTTGCTAGACGAAACAAGAGCATACTTCCGGGCAACCTTTGGCTTCA
ATAATGTGAAGCTGGGCAGCTCATTCCCCCGCTTTTGGCCCGGGATACCCCAGGACCTTCCAGAAACAGTGCAAC
ATTTCTTCACTCACCGTGGTTTCCGACTCAGCCCTCCCAGTGCCCGGTCGGTTGATTTGTACCAAGATATTCGGA
ACTTCCAGTCGCCAGAGAAGTATATCACTCGTGCCCGGGAGCGAGGCTTCCGCTTCGCGCCATTAAAACCCGAAG
ATTACGAGGCCTGTTTGGTTGGCCAAAGAAAAAACTTCTCTAAGGACAGTGTAAGACTCCTGTGTTTCTCTCCAC
TTGTACTTTGTTGGAATTCATACTAAAATTTTATCAAGAGCTGGGTGGAGGCATACGTCGCTTTACATCCCGACA
AGTATCCCGACAGTGTGATGATAGCATTCGACTCTCACGGCCAGCAGGTTGGTTGGACACTAATGCTCGGTCCAT
CATATGCTTTGAACAAGTCTTGGGCATTCCCCCAAACCTGTGGTCCAAACACAGGGCTCATTGGTGCCGTAGGAA
TTGATGAATCACACCGCAAGCATGGCATTGGACTGGCATTGATCTGTCATGCTATTGAAAACATGAAGCAGCGAG
GCATTGAAGGTGTCTTTGTAGACTGGGTTGCGCTCGACGGGTGGTATGAGCAGGTTGGGTTCAAGACCTGGAGAA
GCTACAGGCCCGGGGAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail