Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2768.t1
Gene name
Locationscaffold_03:902259..904348
Strand-
Gene length (bp)2089
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 5.0E-119 44 514

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 138 157 19
3 170 192 22
4 234 256 22
5 263 285 22
6 323 345 22
7 357 379 22
8 389 408 19
9 421 443 22
10 485 507 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2768.t1
MAEIHENGKNPTSVQVAASQPHSTLEEYEQLFGVDEDAYEQPTTTRKELWSYYLYYNGDNGVGPGSYSQALFQWA
LNGAGHQPGSNPPKACTDSSACVVPWAGGTRSVSSVVLIANGLCFTFMTVIFVWLGSAADYGTFGRWLLLALTVV
CWALQYGMMSIRHPSQWPTAMALYVVSYIAYGATLVFYAAVFPRLARYTPHVRKAREEDLREGKINQEEYDTVES
LERNHISNISTAHSNIGYLFTLVLNLSVLLPLQNNTFSNNLALCLTNSYWVVLGIWWFIFQQKRPGPKIPKGSSY
TTIGFKQIWLAIREIRSLPQTFLYFFAYFLLADGLNTTGTLVSIIQNDSVSFSFLQITYLGITQAACSITSTFGF
WYIQQYFKFKTKTMFLFTNFFTVLIPFWGMLGLWTDRIGYHNRWEFYFYNIIFGLFQAPYYAYAQTMISELMPRG
YDNMFFALFGITNRASSIIGPNVIQAIINNTHNNWMGFPFLFAICAGAMIAICFVDIKKGREDCREFTEKRKIDR
VVAESGLDPAYIAKGKQSARNEDVPEVQNELASTSVRE*
Coding >Pro_DTO377G3_2|g2768.t1
ATGGCTGAAATTCATGAAAATGGTAAAAACCCCACATCGGTTCAGGTGGCCGCCTCACAGCCACATTCTACCTTG
GAGGAGTATGAACAGCTCTTTGGCGTCGACGAGGACGCGTATGAGCAGCCAACCACCACTAGGAAAGAACTATGG
TCCTATTATCTCTATTACAATGGCGATAACGGTGTCGGTCCGGGATCGTACAGTCAAGCTCTCTTCCAGTGGGCC
TTGAACGGTGCCGGACATCAACCTGGCTCGAATCCACCTAAAGCCTGCACCGATTCATCGGCATGTGTAGTGCCG
TGGGCGGGAGGCACGAGATCAGTATCTTCCGTGGTTCTTATTGCCAATGGCCTTTGCTTCACTTTCATGACAGTG
ATATTCGTCTGGCTGGGAAGTGCTGCAGACTACGGAACATTCGGCCGATGGCTTCTTCTGGCATTGACAGTGGTC
TGCTGGGCACTGCAGTATGGTATGATGTCCATCCGACATCCAAGCCAGTGGCCAACGGCGATGGCATTGTACGTT
GTTTCATACATTGCCTACGGCGCGACGCTAGTATTCTATGCTGCTGTATTTCCCCGTCTGGCACGGTATACGCCG
CATGTGCGCAAAGCGAGAGAAGAGGATCTCAGAGAGGGTAAGATCAACCAGGAAGAATACGATACGGTTGAATCA
CTGGAGAGAAATCATATCAGCAACATTTCAACTGCACACAGTAACATTGGGTACCTATTCACGCTCGTGCTTAAT
CTTAGCGTCCTGCTTCCACTCCAAAACAACACTTTCTCGAATAACCTGGCCCTCTGTCTTACCAACTCATATTGG
GTCGTTCTTGGCATCTGGTGGTTTATTTTCCAGCAAAAAAGGCCAGGTCCAAAAATACCAAAAGGGTCAAGCTAC
ACCACCATTGGCTTCAAGCAGATCTGGCTGGCCATTCGGGAAATTCGGTCTCTCCCACAGACATTTCTGTACTTT
TTCGCCTATTTCCTTCTTGCCGATGGCCTAAACACTACTGGTACCCTCGTCAGCATCATCCAAAACGACTCCGTC
TCGTTTTCTTTCTTGCAGATTACATATCTCGGCATTACCCAAGCGGCCTGCTCGATCACCTCAACATTCGGCTTT
TGGTATATACAACAGTACTTCAAATTTAAGACAAAGACTATGTTCTTGTTCACAAATTTCTTTACCGTTTTGATC
CCCTTTTGGGGCATGCTAGGACTATGGACCGATCGCATCGGGTATCACAACAGGTGGGAGTTTTACTTCTACAAT
ATCATCTTTGGGCTTTTCCAGGCTCCATACTATGCGTACGCTCAAACGATGATCAGCGAATTGATGCCACGCGGC
TACGATAATATGTTTTTCGCACTTTTTGGAATAACCAATCGCGCTTCTTCAATAATCGGTCCCAATGTCATCCAA
GCCATCATAAACAATACCCACAACAACTGGATGGGCTTCCCATTTTTGTTTGCAATCTGCGCTGGGGCAATGATC
GCTATCTGCTTTGTAGACATCAAAAAGGGTCGTGAGGACTGTCGAGAATTCACCGAAAAGCGCAAGATAGATCGT
GTCGTGGCGGAGAGTGGTCTAGATCCCGCTTATATCGCAAAGGGGAAGCAATCAGCTCGTAACGAAGATGTCCCC
GAAGTGCAAAACGAGCTCGCAAGCACTTCGGTGAGGGAGTGA
Transcript >Pro_DTO377G3_2|g2768.t1
ATGGCTGAAATTCATGAAAATGGTAAAAACCCCACATCGGTTCAGGTGGCCGCCTCACAGCCACATTCTACCTTG
GAGGAGTATGAACAGCTCTTTGGCGTCGACGAGGACGCGTATGAGCAGCCAACCACCACTAGGAAAGAACTATGG
TCCTATTATCTCTATTACAATGGCGATAACGGTGTCGGTCCGGGATCGTACAGTCAAGCTCTCTTCCAGTGGGCC
TTGAACGGTGCCGGACATCAACCTGGCTCGAATCCACCTAAAGCCTGCACCGATTCATCGGCATGTGTAGTGCCG
TGGGCGGGAGGCACGAGATCAGTATCTTCCGTGGTTCTTATTGCCAATGGCCTTTGCTTCACTTTCATGACAGTG
ATATTCGTCTGGCTGGGAAGTGCTGCAGACTACGGAACATTCGGCCGATGGCTTCTTCTGGCATTGACAGTGGTC
TGCTGGGCACTGCAGTATGGTATGATGTCCATCCGACATCCAAGCCAGTGGCCAACGGCGATGGCATTGTACGTT
GTTTCATACATTGCCTACGGCGCGACGCTAGTATTCTATGCTGCTGTATTTCCCCGTCTGGCACGGTATACGCCG
CATGTGCGCAAAGCGAGAGAAGAGGATCTCAGAGAGGGTAAGATCAACCAGGAAGAATACGATACGGTTGAATCA
CTGGAGAGAAATCATATCAGCAACATTTCAACTGCACACAGTAACATTGGGTACCTATTCACGCTCGTGCTTAAT
CTTAGCGTCCTGCTTCCACTCCAAAACAACACTTTCTCGAATAACCTGGCCCTCTGTCTTACCAACTCATATTGG
GTCGTTCTTGGCATCTGGTGGTTTATTTTCCAGCAAAAAAGGCCAGGTCCAAAAATACCAAAAGGGTCAAGCTAC
ACCACCATTGGCTTCAAGCAGATCTGGCTGGCCATTCGGGAAATTCGGTCTCTCCCACAGACATTTCTGTACTTT
TTCGCCTATTTCCTTCTTGCCGATGGCCTAAACACTACTGGTACCCTCGTCAGCATCATCCAAAACGACTCCGTC
TCGTTTTCTTTCTTGCAGATTACATATCTCGGCATTACCCAAGCGGCCTGCTCGATCACCTCAACATTCGGCTTT
TGGTATATACAACAGTACTTCAAATTTAAGACAAAGACTATGTTCTTGTTCACAAATTTCTTTACCGTTTTGATC
CCCTTTTGGGGCATGCTAGGACTATGGACCGATCGCATCGGGTATCACAACAGGTGGGAGTTTTACTTCTACAAT
ATCATCTTTGGGCTTTTCCAGGCTCCATACTATGCGTACGCTCAAACGATGATCAGCGAATTGATGCCACGCGGC
TACGATAATATGTTTTTCGCACTTTTTGGAATAACCAATCGCGCTTCTTCAATAATCGGTCCCAATGTCATCCAA
GCCATCATAAACAATACCCACAACAACTGGATGGGCTTCCCATTTTTGTTTGCAATCTGCGCTGGGGCAATGATC
GCTATCTGCTTTGTAGACATCAAAAAGGGTCGTGAGGACTGTCGAGAATTCACCGAAAAGCGCAAGATAGATCGT
GTCGTGGCGGAGAGTGGTCTAGATCCCGCTTATATCGCAAAGGGGAAGCAATCAGCTCGTAACGAAGATGTCCCC
GAAGTGCAAAACGAGCTCGCAAGCACTTCGGTGAGGGAGTGA
Gene >Pro_DTO377G3_2|g2768.t1
ATGGCTGAAATTCATGAAAATGGTAAAAACCCCACATCGGTTCAGGTGGCCGCCTCACAGCCACATTCTACCTTG
GAGGAGTATGAACAGCTCTTTGGCGTCGACGAGGACGCGTATGAGCAGCCAACCACCACTAGGAAAGAACTATGG
TCCTATTATCTCTATTACAATGGCGATAACGGTGTCGGTCCGGGATCGTACAGTCAAGCTCTGTATGTACAAATG
GCAACGCTGGAATTTTTCGACTAATCCCATGAAGCTTCCAGTGGGCCTTGAACGGTGCCGGACATCAACCTGGCT
CGAATCCACCTAAAGCCTGCACCGATTCATCGGCATGTGTAGTGCCGTGGGCGGGAGGCACGAGATCAGTATCTT
CCGTGGTTCTTATTGCCAATGGCCTTTGCTTCACTTTCATGACAGTGATATTCGTCTGGCTGGGAAGTGCTGCAG
ACTACGGAACATTCGGCCGATGGCTTCTTCTGGCATTGACAGTGGTCTGCTGGGCACTGCAGTATGGTATGATGT
CCATCCGACATCCAAGCCAGTGGCCAACGGCGATGGCATTGTACGTTGTTTCATACATTGCCTACGGCGCGACGC
TAGTATTCTATGCTGCTGTATTTCCCCGTCTGGCACGGTATACGCCGCATGTGCGCAAAGCGAGAGAAGAGGATC
TCAGAGAGGGTAAGATCAACCAGGAAGAATACGATACGGTTGAATCACTGGAGAGAAATCATATCAGGTGAGTTG
GGAAACTTTGAGCTCCTGGCCAAGATGTCGCTGACGATAGTAGCAACATTTCAACTGCACACAGTAACATTGGGT
ACCTATTCACGCTCGTGCTTAATCTTAGCGTCCTGCTTCCACTCCAAAACAACACTTTCTCGAATAACCTGGCCC
TCTGTCTTACCAACTCATGTAAGCTTTCTGAGCAGTCAATCTAGTGTGGGATTTATCTAACGTTCTACAGATTGG
GTCGTTCTTGGCATCTGGTGGTTTATTTTCCAGCAAAAAAGGCCAGGTCCAAAAATACCAAAAGGGTCAAGCTAC
ACCACCATTGGCTTCAAGCAGATCTGGCTGGCCATTCGGGAAATTCGGTCTCTCCCACAGACATTTCTGTACTTT
TTCGCCTATTTCCTTCTTGCCGATGGCCTAAACACTACTGGTGGGTTCATTCCTTCTTTGCTTGCTGCAACGAGA
CTCTATAGCCCCATGTGGACAAGGGAATTCACTAATATGAATTATTAGGTACCCTCGTCAGCATCATCCAAAACG
ACTCCGTCTCGTTTTCTTTCTTGCAGATTACATATCTCGGCATTACCCAAGCGGCCTGCTCGATCACCTCAACAT
TCGGCTTTTGGTATATACAACAGTACTTCAAATTTAAGACAAAGACTATGTTCTTGTTCACAAATTTCTTTACCG
TTTTGATCCCCTTTTGGGGCATGCTAGGACTATGGACCGATCGCATCGGGTATCACAACAGGGTATGTATCAGGC
CCCAACTGAGAGTCTGCAGCTAACAGCCATGGAGTGGGAGTTTTACTTCTACAATATCATCTTTGGGCTTTTCCA
GGCTCCATACTATGCGGTAGGTGGAACTTTGAATGGTCTTCAACACAATTCCTGCTCCCATAGCTTCTAATATCG
TGCCAGTACGCTCAAACGATGATCAGCGAATTGATGCCACGCGGCTACGATAATATGTTTTTCGCACTTTTTGGA
ATAACCAATCGCGCTGTAAGTCGGATGTCTTGAATGTTATATTTCCTTCGAATCACTAACCTTCTAGTCTTCAAT
AATCGGTCCCAATGTCATCCAAGCCATCATAAACAATACCCACAACAACTGGATGGGCTTCCCATTTTTGTTTGC
AATCTGCGCTGGGGCAATGATCGCTATCTGCTTTGTAGACATCAAAAAGGGTCGTGAGGACTGTCGAGAATTCAC
CGAAAAGCGCAAGATAGATCGTGTCGTGGCGGAGAGTGGTCTAGATCCCGCTTATATCGCAAAGGGGAAGCAATC
AGCTCGTAACGAAGATGTCCCCGAAGTGCAAAACGAGCTCGCAAGCACTTCGGTGAGGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail